Recombinant Aquifex aeolicus Uncharacterized protein aq_757 (aq_757)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant aq_757 is expressed in E. coli with a His-tag for purification and structural studies. It corresponds to the full-length protein (residues 1–179) encoded by the aq_757 gene in A. aeolicus . The protein is classified as "uncharacterized," indicating limited functional or mechanistic data in published literature.

PropertyDetail
Host SpeciesAquifex aeolicus (strain VF5)
Expression SystemE. coli
TagHis-tag
Protein Length179 amino acids
UniProt IDO66959
Molecular WeightNot explicitly reported; inferred from sequence (~20–22 kDa)

Biochemical Production and Stability

Recombinant aq_757 is produced in E. coli and purified under denaturing conditions (6 M urea) or natively, depending on solubility .

  • Storage: Tris-based buffer with 50% glycerol at -20°C or -80°C .

  • Purity: >85% as verified by SDS-PAGE .

Research Applications

While functional studies are absent, the protein’s availability supports:

  • Antibody Development: Used as an antigen in ELISA assays .

  • Structural Biology: Potential crystallization or NMR studies (though no structures are reported).

Gaps in Functional Characterization

No experimental data on pathways, interactions, or biochemical roles are available. Public databases (e.g., UniProt, KEGG) classify aq_757 as a "hypothetical protein" with no annotated partners or activities .

Comparative Insights from Related Proteins

While aq_757 itself is uncharacterized, studies on other A. aeolicus proteins provide context:

  • Thermostability Adaptations: Proteins like Ribonuclease III (RNase III) and Ribonucleotide Reductase (RNR) from A. aeolicus exhibit extreme thermal stability, with optimal activity at 70–85°C .

  • Intein-Dependent Maturation: Some A. aeolicus proteins (e.g., RNR β-subunit) require intein splicing for metal cofactor incorporation , though no intein is reported in aq_757.

Future Directions

Critical research steps include:

  1. Functional Assays: Screen for enzymatic activity or ligand binding.

  2. Structural Studies: Resolve 3D architecture to infer potential roles.

  3. Interaction Mapping: Identify binding partners via yeast two-hybrid or co-IP.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Please contact us in advance to arrange dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
aq_757; Uncharacterized protein aq_757
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
aq_757
Target Protein Sequence
MKAESVSQWILVILFATLLFFAFTGIFVSTLLVVLTPEGFAFLLGFLGALVFANKLLFGY GSFVITAEAFLTNKEIDRRELAKKTNEPVERTENLSIPALLALWLAGLDYYRYAYYGIFT LMLIIMLLSKFDLLGALTIGNYFEGAFWGAAVITLFVFALEITANYLMARINEEVSLNG
Uniprot No.

Target Background

Database Links

KEGG: aae:aq_757

STRING: 224324.aq_757

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Aquifex aeolicus and why is it significant for protein research?

Aquifex aeolicus is a hyperthermophilic bacterium belonging to one of the most deeply branched families within the bacterial domain. This organism is particularly significant for evolutionary studies and protein research due to its position in the phylogenetic tree and its extreme thermophilic properties. A. aeolicus has drawn research interest for its unique topoisomerase characteristics, which differ from most bacteria in that it possesses a naturally chimeric type IIA topoisomerase that exhibits properties of both gyrase and topo IV . This makes proteins from A. aeolicus, including uncharacterized ones like aq_757, valuable for understanding protein evolution and adaptation to extreme environments.

To effectively work with proteins from this organism, researchers should consider:

  • Temperature optimization for experiments (optimal activity for A. aeolicus enzymes is often observed around 70°C)

  • Structural adaptations that may confer thermostability

  • Evolutionary relationships that may provide clues to function

What are the optimal storage conditions for recombinant aq_757 protein?

For optimal stability and activity preservation of recombinant aq_757 protein, the following storage conditions are recommended:

  • Long-term storage: Store at -20°C or preferably -80°C

  • Working aliquots: Store at 4°C for up to one week

  • Buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Stability enhancement: Addition of glycerol (recommended final concentration of 50%) for long-term storage

  • Aliquoting: Divide into single-use aliquots to avoid repeated freeze-thaw cycles

It is important to note that repeated freezing and thawing can significantly reduce protein activity and should be avoided. Researchers should centrifuge the vial briefly before opening to bring contents to the bottom, particularly after thawing or when working with lyophilized material.

How should recombinant aq_757 be reconstituted for experimental use?

The recommended protocol for reconstituting lyophilized aq_757 protein is as follows:

  • Centrifuge the vial briefly before opening to bring the contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 5-50% (preferably 50%)

  • Aliquot into single-use volumes to prevent repeated freeze-thaw cycles

  • Store reconstituted aliquots according to the storage conditions described previously

For experiments requiring specific buffer conditions, researchers may need to dialyze the reconstituted protein against the desired buffer. When working with this thermophilic protein, consider that optimal activity may require higher temperature conditions than typical for mesophilic proteins, as indicated by studies on other A. aeolicus proteins that show optimal activity around 70°C .

What experimental approaches are most effective for determining the function of an uncharacterized protein like aq_757?

For uncharacterized proteins like aq_757, a multi-faceted approach is recommended:

  • Computational Analysis:

    • Sequence homology searches against characterized proteins

    • Structural prediction and modeling

    • Domain identification and function prediction

    • Genomic context analysis (examining neighboring genes)

  • Biochemical Characterization:

    • Substrate screening assays

    • Enzymatic activity tests at various temperatures (particularly important for thermophilic organisms like A. aeolicus)

    • Protein-protein interaction studies

    • Post-translational modification analysis

  • Structural Biology:

    • X-ray crystallography or cryo-EM for 3D structure determination

    • Nuclear Magnetic Resonance (NMR) for structural dynamics

    • Circular dichroism for secondary structure analysis

  • Genetic Approaches:

    • Gene knockout/knockdown studies (if possible in A. aeolicus or a model organism)

    • Heterologous expression studies

    • Complementation assays

  • Pathway Analysis:

    • Metabolomics to identify affected pathways

    • Expression profiling under various conditions

The example of type IIA topoisomerase research in A. aeolicus demonstrates the value of combining structural and biochemical analyses. Researchers determined the crystal structure of the C-terminal domain to 1.3 Å resolution and characterized its functionality through DNA binding and manipulation assays, ultimately resolving questions about its evolutionary heritage and functional properties .

How can researchers address potential issues with protein solubility and stability when working with aq_757?

Working with membrane proteins or proteins from extremophiles like A. aeolicus often presents solubility and stability challenges. For aq_757, consider these methodological approaches:

  • Solubility Enhancement Strategies:

    • Optimization of expression conditions (temperature, induction parameters)

    • Use of solubility-enhancing fusion tags (beyond the His-tag)

    • Co-expression with chaperones

    • Screening various detergents for membrane protein solubilization

    • Testing different buffer compositions

  • Stability Optimization:

    • Temperature screening (considering A. aeolicus' thermophilic nature)

    • Buffer optimization (pH, ionic strength, additives)

    • Addition of stabilizers such as glycerol, trehalose, or specific ions

    • Protection from oxidation (addition of reducing agents)

  • Experimental Design Considerations:

    • For thermal stability assays, use a wide temperature range (up to 90°C)

    • Include appropriate controls from mesophilic organisms for comparison

    • Monitor stability over time under experimental conditions

When working with the aq_757 protein specifically, researchers should note that it comes in a buffer containing 6% Trehalose (pH 8.0), which has been optimized for stability . Any buffer exchanges should carefully consider this initial formulation.

What approaches are recommended for analyzing potential protein-protein interactions involving aq_757?

To investigate protein-protein interactions (PPIs) for an uncharacterized protein like aq_757, consider this methodological workflow:

  • In Silico Prediction:

    • Sequence-based PPI prediction tools

    • Structural modeling to identify potential interaction interfaces

    • Analysis of conserved domains known to mediate PPIs

  • Physical Interaction Methods:

    • Pull-down assays using the His-tagged aq_757

    • Co-immunoprecipitation with suspected interaction partners

    • Crosslinking coupled with mass spectrometry

    • Surface plasmon resonance for interaction kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

  • Cell-Based Approaches:

    • Bacterial two-hybrid system (adapted for thermophilic conditions)

    • Proximity-based labeling techniques

    • Fluorescence resonance energy transfer (FRET)

  • Considerations for Thermophilic Proteins:

    • High-temperature adaptations for interaction assays

    • Comparative analysis with mesophilic homologs

    • Interaction stability across temperature ranges

When designing experiments, researchers should consider that standard PPI detection methods may need modification for thermophilic proteins like those from A. aeolicus, which may form stable interactions at higher temperatures but dissociate under standard laboratory conditions.

How can functional domain predictions guide experimental design for aq_757 research?

Functional domain prediction is a crucial starting point for experimental design when working with uncharacterized proteins. For aq_757, this approach would involve:

  • Domain Identification Process:

    • Use of multiple prediction algorithms (InterProScan, SMART, Pfam)

    • Hidden Markov Model (HMM) searches against domain databases

    • Secondary structure prediction to identify structural motifs

    • Transmembrane domain prediction (particularly relevant given the amino acid sequence of aq_757)

  • Translation to Experimental Design:

    • Design of truncation constructs based on predicted domains

    • Site-directed mutagenesis of key residues within predicted functional motifs

    • Selection of appropriate functional assays based on domain predictions

    • Development of domain-specific antibodies or probes

  • Iterative Refinement:

    • Experimental validation of predicted domains

    • Structural studies to confirm domain boundaries

    • Functional assays to verify predicted activities

For aq_757, sequence analysis suggests potential transmembrane regions, which would guide experimental design toward membrane protein characterization techniques, solubilization strategies, and functional assays relevant to membrane-associated processes.

What experimental controls are essential when characterizing an uncharacterized protein like aq_757?

  • Negative Controls:

    • Buffer-only conditions to establish baselines

    • Denatured protein samples to confirm that activity requires native structure

    • Unrelated proteins of similar size/structure to test specificity

    • Empty vector expressions for background activity

    • Samples lacking essential cofactors or substrates

  • Positive Controls:

    • Well-characterized proteins with known functions for assay validation

    • When possible, homologous proteins with known functions from related organisms

    • For A. aeolicus proteins, considering the characterized type IIA topoisomerase as a methodological reference

  • Technical Controls:

    • Multiple biological and technical replicates

    • Concentration gradients to establish dose-dependency

    • Time-course experiments to capture kinetics

    • Temperature range tests (particularly important for thermophilic proteins)

    • Different expression systems to rule out host-specific artifacts

  • Validation Controls:

    • Alternative methods to confirm key findings

    • Rescued function through complementation

    • Structure-function relationship verification through mutagenesis

The approach used in studying A. aeolicus topoisomerase provides a methodological template: researchers conducted structural analysis alongside multiple biochemical assays (negative supercoiling, DNA relaxation) and included comparative analyses with known enzymes, ultimately enabling clear functional classification .

How should researchers interpret contradictory results in functional assays of aq_757?

When faced with contradictory results in functional assays of uncharacterized proteins like aq_757, researchers should implement this systematic approach:

  • Critical Assessment of Methodology:

    • Verify assay conditions (temperature, pH, buffer composition, cofactors)

    • Evaluate protein quality (purity, integrity, folding)

    • Assess experimental timing (protein stability over assay duration)

    • Review sample preparation methods for inconsistencies

  • Biological Explanations:

    • Consider multifunctional protein possibilities

    • Evaluate context-dependent functionality

    • Assess potential post-translational modifications

    • Examine oligomerization states and their impact on function

  • Resolution Strategies:

    • Employ orthogonal methods to test the same hypothesis

    • Conduct structure-function analyses through site-directed mutagenesis

    • Utilize dose-response relationships to clarify mechanism

    • Compare results across different experimental conditions

  • Integrative Analysis:

    • Combine in silico predictions with experimental data

    • Compare with known homologs from other species

    • Integrate results from multiple assay types

    • Consider evolutionary context for functional divergence

The research on A. aeolicus type IIA topoisomerase illustrates this approach: when faced with conflicting phylogenetic classification (gyrase-like) and functional data (topo IV-like activity), researchers conducted subunit-mixing experiments and CTD-swapping to resolve the contradiction, ultimately discovering a naturally chimeric enzyme that provided insight into topoisomerase evolution .

What comparative genomics approaches would be valuable for studying aq_757?

Comparative genomics provides powerful insights for uncharacterized proteins like aq_757 through these methodological approaches:

  • Homology Analysis:

    • Identification of orthologs across species with varying evolutionary distances

    • Analysis of paralogs within A. aeolicus

    • Construction of phylogenetic trees to understand evolutionary relationships

    • Calculation of selection pressure (dN/dS ratios) to infer functional constraints

  • Genomic Context Analysis:

    • Examination of gene neighborhood conservation (synteny)

    • Identification of operons or gene clusters

    • Detection of co-evolved genes across multiple genomes

    • Functional coupling analysis based on genomic proximity

  • Structural Comparison:

    • Structural alignment with solved protein structures

    • Domain architecture comparison across homologs

    • Identification of conserved structural motifs

    • Analysis of thermostability adaptations in homologs from different thermal environments

  • Experimental Validation:

    • Heterologous complementation experiments

    • Functional testing of predicted orthologs

    • Comparative biochemical characterization

The approach used to study the type IIA topoisomerase in A. aeolicus demonstrates the value of comparative analysis: researchers compared the A. aeolicus enzyme with well-characterized counterparts from E. coli and conducted subunit-mixing experiments, revealing a unique evolutionary history that helped explain its functional properties .

How can researchers design experiments to test hypothesized functions of aq_757?

To design experiments testing hypothesized functions of aq_757, follow this methodological framework:

  • Hypothesis Formulation:

    • Based on sequence analysis and predicted domains

    • Informed by genomic context and potential pathway involvement

    • Guided by homology to proteins with known functions

    • Consider the extreme thermophilic nature of A. aeolicus

  • Experimental Design Strategy:

    • Direct functional assays based on predicted activities

    • Protein-protein interaction studies with predicted partners

    • Localization studies (particularly important for potential membrane proteins)

    • Expression analysis under varying conditions

  • Validation Approaches:

    • Site-directed mutagenesis of predicted functional residues

    • Domain deletion or swapping experiments

    • Complementation of mutant phenotypes

    • Heterologous expression studies

  • Technical Considerations for A. aeolicus Proteins:

    • Temperature optimization (testing activity range from 37-90°C)

    • Buffer conditions suitable for thermostable proteins

    • Consideration of potential cofactors or metal ions

    • Special handling for membrane proteins if transmembrane domains are present

The research approach for A. aeolicus type IIA topoisomerase provides an excellent template: researchers conducted structural analysis of the CTD to 1.3 Å resolution, performed activity assays with different DNA substrates, and carried out domain-swapping experiments that demonstrated the functional significance of the CTD, ultimately clarifying the enzyme's evolutionary origin and functional classification .

What are the optimal expression and purification strategies for recombinant aq_757?

For optimal expression and purification of recombinant aq_757, researchers should consider this methodological approach:

  • Expression System Optimization:

    • E. coli has been successfully used for aq_757 expression

    • Consider strain selection: BL21(DE3), Rosetta, or C41/C43 for potential membrane proteins

    • Optimize induction parameters (temperature, IPTG concentration, induction time)

    • Evaluate co-expression with chaperones for improved folding

  • Purification Strategy:

    • Leverage the N-terminal His-tag for IMAC (Immobilized Metal Affinity Chromatography)

    • Consider a two-step purification approach:
      a. IMAC for initial capture
      b. Size exclusion chromatography for higher purity

    • For challenging purifications, evaluate ion exchange as an intermediate step

  • Quality Control Assessments:

    • SDS-PAGE for purity verification (>90% purity is achievable)

    • Western blot for identity confirmation

    • Mass spectrometry for exact mass determination

    • Circular dichroism for secondary structure evaluation

    • Dynamic light scattering for homogeneity assessment

  • Special Considerations for Thermophilic Proteins:

    • Higher temperature may be required during cell lysis and purification steps

    • Buffer stability at elevated temperatures

    • Thermostability testing of the purified protein

The commercially available recombinant aq_757 is expressed in E. coli with N-terminal His-tag and purified to >90% purity as determined by SDS-PAGE , demonstrating the feasibility of this approach.

How can researchers effectively study potential membrane association of aq_757?

Based on sequence analysis showing multiple hydrophobic regions, aq_757 may be a membrane-associated protein. To study this aspect effectively:

  • Computational Prediction:

    • Transmembrane domain prediction using multiple algorithms (TMHMM, Phobius, HMMTOP)

    • Hydropathy plot analysis

    • Signal peptide prediction

    • Lipid modification site prediction

  • Biochemical Characterization:

    • Membrane fractionation experiments

    • Detergent solubilization screening

    • Protease accessibility assays

    • Liposome association studies

    • Alkali extraction to differentiate peripheral vs. integral membrane proteins

  • Structural Studies:

    • Circular dichroism in membrane-mimetic environments

    • NMR studies with isotopically labeled protein in detergent micelles

    • Cryo-EM for larger membrane protein complexes

    • X-ray crystallography with appropriate detergents or lipidic cubic phase

  • Localization Studies:

    • Fusion to fluorescent proteins (if heterologous expression is possible)

    • Immunolocalization with specific antibodies

    • Membrane topology mapping with cysteine accessibility methods

The amino acid sequence of aq_757 suggests potential transmembrane regions with stretches of hydrophobic residues , making these approaches particularly relevant for understanding its cellular localization and function.

What considerations are important for designing thermal stability assays for aq_757?

When designing thermal stability assays for aq_757, a protein from the hyperthermophile A. aeolicus, consider these methodological approaches:

  • Temperature Range Selection:

    • Extend standard thermal stability assays to high temperatures (up to 90-100°C)

    • Include relevant control proteins from mesophilic organisms

    • Establish baseline stability at different starting temperatures

    • Consider temperature increments that capture the thermostability profile

  • Method Selection and Adaptation:

    • Differential Scanning Calorimetry (DSC) with high-temperature capability

    • Differential Scanning Fluorimetry (DSF) with thermostable dyes

    • Circular Dichroism with temperature control for secondary structure monitoring

    • Activity assays at various temperatures to correlate structure and function

  • Buffer and Condition Optimization:

    • Evaluate stability in different buffer systems

    • Test the effect of additives (glycerol, trehalose, ions)

    • Assess pH stability across temperature ranges

    • Examine concentration-dependent effects

  • Data Analysis Approaches:

    • Determination of melting temperature (Tm)

    • Calculation of activation energy for unfolding

    • Analysis of unfolding cooperativity

    • Comparative analysis with homologous proteins

Research on other A. aeolicus proteins indicates optimal activity around 70°C , suggesting aq_757 may also exhibit thermostable properties requiring specialized assay conditions beyond standard laboratory temperature ranges.

How should researchers approach data analysis when comparing aq_757 with homologs from mesophilic organisms?

When comparing aq_757 with homologs from mesophilic organisms, implement this analytical framework:

  • Sequence-Based Comparative Analysis:

    • Multiple sequence alignment to identify conserved and divergent regions

    • Calculation of sequence identity and similarity percentages

    • Identification of thermophile-specific sequence adaptations

    • Evolutionary rate analysis to detect sites under selective pressure

  • Structural Comparison Methodology:

    • Homology modeling based on available structures

    • Comparison of stabilizing interactions (ionic bonds, disulfide bridges, hydrophobic cores)

    • Analysis of flexibility/rigidity patterns

    • Surface charge distribution comparison

  • Functional Parameters Analysis:

    • Temperature optima and activity ranges

    • Kinetic parameters (Km, kcat, temperature dependence)

    • Stability metrics (half-life at different temperatures)

    • Substrate specificity differences

  • Statistical Approaches:

    • Normalization methods for cross-temperature comparisons

    • Appropriate statistical tests for significance determination

    • Multivariate analysis for complex property relationships

    • Regression analysis for temperature-dependent parameters

The comparative approach used in the A. aeolicus type IIA topoisomerase study provides a methodological example: researchers conducted activity assays under comparable conditions for enzymes from different organisms and performed subunit mixing experiments that revealed functional compatibility between domains from different species .

What approaches can help resolve contradictory findings in structure-function studies of aq_757?

When faced with contradictory structure-function findings for aq_757, employ this resolution framework:

  • Methodological Verification:

    • Cross-validation using multiple structural analysis techniques

    • Confirmation of protein integrity before and after experiments

    • Evaluation of experimental conditions, particularly temperature effects

    • Assessment of protein complex formation or oligomerization states

  • Multi-level Structure Analysis:

    • Compare predictions from multiple structural modeling algorithms

    • Validate key structural features through limited proteolysis

    • Employ hydrogen-deuterium exchange for conformational analysis

    • Use small-angle X-ray scattering for solution structure validation

  • Targeted Mutagenesis Approach:

    • Design mutations to test specific structural hypotheses

    • Create chimeric proteins to isolate functional domains

    • Introduce stabilizing mutations to test structural models

    • Employ alanine scanning of predicted functional sites

  • Integrative Data Analysis:

    • Combine data from multiple techniques with appropriate weighting

    • Apply Bayesian approaches to reconcile conflicting evidence

    • Develop structure-function correlation matrices

    • Use molecular dynamics simulations to test conformational hypotheses

The A. aeolicus type IIA topoisomerase research exemplifies this approach: when faced with contradictory classification evidence, researchers resolved the issue by experimenting with domain swapping. Replacing the A. aeolicus CTD with one from T. maritima created an enzyme with gyrase-like supercoiling activity, demonstrating that domain function could be experimentally verified and contradictions resolved .

How can aq_757 research contribute to understanding protein evolution in extremophiles?

Research on aq_757 offers valuable insights into protein evolution in extremophiles through these analytical approaches:

  • Evolutionary Adaptation Analysis:

    • Identification of thermostability-conferring amino acid compositions

    • Comparative analysis with mesophilic homologs

    • Detection of convergent evolution patterns across different extremophile lineages

    • Investigation of domain conservation and diversification

  • Phylogenetic Context Examination:

    • Placement of aq_757 in the broader evolutionary history of its protein family

    • Analysis of selection pressures along different lineages

    • Identification of key evolutionary transitions

    • Reconstruction of ancestral sequences

  • Structure-Function Relationship Investigation:

    • Analysis of how structural adaptations modify function

    • Comparison of catalytic efficiency across temperature ranges

    • Assessment of conformational flexibility trade-offs

    • Identification of structural features that maintain function at high temperatures

  • Research Applications:

    • Design of thermostable proteins for biotechnological applications

    • Understanding fundamental principles of protein stability

    • Insights into early evolution under extreme conditions

    • Development of predictive models for protein adaptation

The study of A. aeolicus type IIA topoisomerase demonstrates how research on proteins from deeply branched bacterial lineages can provide insights into evolutionary processes, revealing the existence of naturally chimeric enzymes and suggesting evolutionary paths for the generation of bacterial type IIA paralogs .

What experimental design is recommended for studying potential post-translational modifications of aq_757?

To investigate potential post-translational modifications (PTMs) of aq_757, implement this comprehensive experimental approach:

  • In Silico Prediction:

    • Computational prediction of common PTM sites (phosphorylation, glycosylation, etc.)

    • Analysis of sequence motifs associated with specific modifications

    • Comparison with known modified sites in homologous proteins

    • Evaluation of PTM site conservation across species

  • Mass Spectrometry Approaches:

    • Bottom-up proteomics with enrichment strategies for specific PTMs

    • Top-down proteomics for intact protein analysis

    • Multiple fragmentation methods (CID, ETD, HCD) for comprehensive coverage

    • Quantitative analysis to determine modification stoichiometry

  • Biochemical Verification Methods:

    • Western blotting with modification-specific antibodies

    • Enzymatic treatment to remove specific modifications

    • Mobility shift assays to detect modifications

    • Chemical labeling of specific modified residues

  • Functional Impact Assessment:

    • Site-directed mutagenesis of predicted modification sites

    • Activity assays comparing modified and unmodified forms

    • Structural analysis to determine conformational effects of modifications

    • Protein-protein interaction studies to assess effects on complex formation

For thermophilic proteins like aq_757, special consideration should be given to temperature-dependent PTM stability and the potential role of modifications in thermoadaptation.

What are the major technical challenges in functional characterization of aq_757 and how can they be addressed?

Functional characterization of aq_757 presents several technical challenges that can be addressed through these methodological approaches:

  • Thermostability and Assay Compatibility:
    Challenge: Standard assay conditions may not be suitable for thermophilic proteins.
    Solution:

    • Develop high-temperature compatible assay systems

    • Use thermostable reagents and equipment

    • Include appropriate thermostable controls

    • Consider temperature gradients to identify optimal conditions

  • Membrane Protein Characterization:
    Challenge: If aq_757 is membrane-associated, this presents specific handling difficulties.
    Solution:

    • Screen multiple detergents for optimal solubilization

    • Consider nanodiscs or liposomes for native-like environments

    • Employ cell-free expression systems with membrane mimetics

    • Use specialized purification strategies for membrane proteins

  • Function Prediction Limitations:
    Challenge: Lack of characterized homologs complicates function prediction.
    Solution:

    • Employ sensitive sequence analysis tools (HHpred, PSSM-based searches)

    • Consider structural prediction and threading approaches

    • Design broad-spectrum activity screening assays

    • Utilize genome context for functional hints

  • Experimental Validation:
    Challenge: Genetic manipulation in A. aeolicus is difficult.
    Solution:

    • Utilize heterologous expression systems

    • Consider complementation in model organisms

    • Develop in vitro reconstitution systems

    • Use chemical genetics approaches

The research approach for A. aeolicus type IIA topoisomerase provides a template for addressing similar challenges: researchers optimized temperature conditions (finding 70°C as optimal), conducted comprehensive activity screening, and utilized domain-swapping experiments to overcome technical limitations .

How should researchers interpret negative results in functional assays of aq_757?

Negative results in functional assays of aq_757 require careful interpretation through this analytical framework:

  • Technical Validation:

    • Confirm protein quality and integrity

    • Verify assay functionality with appropriate positive controls

    • Evaluate temperature range appropriateness

    • Assess buffer compatibility and potential inhibitory components

  • Biological Context Considerations:

    • Evaluate the need for potential cofactors or binding partners

    • Consider requirement for specific environmental conditions

    • Assess potential activation mechanisms

    • Examine possible substrate specificity limitations

  • Alternative Hypothesis Development:

    • Reformulate functional predictions based on negative results

    • Consider regulatory rather than enzymatic functions

    • Evaluate structural or scaffolding roles

    • Assess potential involvement in protein complexes

  • Expanded Testing Approaches:

    • Broaden substrate screening

    • Modify assay conditions systematically

    • Test function in cellular context rather than purified system

    • Consider unorthodox functions not predicted by sequence alone

The A. aeolicus type IIA topoisomerase study exemplifies productive interpretation of negative results: when the enzyme failed to exhibit gyrase-like negative supercoiling activity, researchers didn't simply conclude a lack of function but instead tested alternative activities, ultimately discovering its robust relaxation and decatenation activities that aligned with topo IV-like properties .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.