Recombinant Aquifex aeolicus Uncharacterized protein aq_850 (aq_850)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage at -20°C/-80°C, we recommend adding 5-50% glycerol (final concentration) and aliquoting. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aq_850; Uncharacterized protein aq_850
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
aq_850
Target Protein Sequence
MALKKLRFEDILLGLTLSLTFLYPLIITLIILYQDAKRKEKEMKIFQKVENIFLSKRCRE RILEIVPYLEFVSDSFIEKLIKVCEFTSGKKPKDKEYKNLEEESLYLIELERGTLKVLGK WISDEEFKLLLITYEPKT
Uniprot No.

Target Background

Database Links

KEGG: aae:aq_850

STRING: 224324.aq_850

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Recombinant Aquifex aeolicus Uncharacterized protein aq_850?

Recombinant Aquifex aeolicus Uncharacterized protein aq_850 (aq_850) is a full-length protein (138 amino acids) derived from the hyperthermophilic bacterium Aquifex aeolicus. It is classified as an uncharacterized protein, meaning its specific biological function remains to be fully elucidated. For research applications, aq_850 is typically produced recombinantly in E. coli expression systems with an N-terminal His-tag to facilitate purification and downstream analysis . The protein is of particular interest to researchers studying extremophile biology, protein structure-function relationships, and adaptation mechanisms in thermophilic organisms.

How is aq_850 classified in protein databases?

In protein databases, aq_850 is classified as follows:

Classification ParameterInformation
Database IdentifierUniProt: O67017
OrganismAquifex aeolicus (strain VF5)
Protein TypeTransmembrane Protein
LengthFull Length (138 amino acids)
Gene Designationaq_850
StatusUncharacterized

The "uncharacterized" classification indicates that while the protein's sequence is known and it has been identified in the Aquifex aeolicus genome, its specific biological function, enzymatic activity, and role in cellular processes remain to be experimentally determined . This classification serves as a starting point for comparative analyses with other proteins, potentially identifying functional similarities based on sequence homology or structural predictions.

What expression and purification strategies are recommended for recombinant aq_850?

Given the transmembrane nature and thermophilic origin of aq_850, specialized expression and purification approaches are necessary:

Expression Strategy:

  • Host selection: BL21(DE3) or Rosetta(DE3) E. coli strains are recommended for membrane proteins

  • Vector design: pET-based vectors with T7 promoter systems and N-terminal His-tag

  • Induction parameters:

    • Temperature: 16-20°C (lower temperatures improve membrane protein folding)

    • IPTG concentration: 0.1-0.5 mM

    • Duration: 16-20 hours

Purification Protocol:

  • Cell lysis in buffer containing:

    • 50 mM Tris-HCl pH 8.0

    • 300 mM NaCl

    • 1% detergent (n-dodecyl-β-D-maltoside or Triton X-100)

    • Protease inhibitor cocktail

  • Immobilized metal affinity chromatography (IMAC):

    • Ni-NTA resin binding

    • Washing with increasing imidazole (20-60 mM)

    • Elution with 250-300 mM imidazole

  • Size exclusion chromatography:

    • Further purification and buffer exchange

    • Assessment of oligomeric state

  • Quality control:

    • SDS-PAGE with target purity >90%

    • Western blotting with anti-His antibodies

Researchers should be aware that RNA contamination has been observed with other Aquifex aeolicus proteins during purification steps, which may necessitate additional RNase treatment or ion-exchange chromatography to separate protein from nucleic acids .

How should recombinant aq_850 be stored to maintain stability?

Proper storage is crucial for maintaining the structural integrity and functional properties of aq_850:

Storage DurationRecommended Conditions
Short-term (≤1 week)4°C in buffer with 5-10% glycerol and appropriate detergent
Long-term (months)−20°C with 20-50% glycerol, in single-use aliquots
Extended storage−80°C, flash-frozen in liquid nitrogen first

The shelf life of liquid formulations is typically around 6 months at −20°C/−80°C, while lyophilized formulations can be stable for up to 12 months at −20°C/−80°C . Repeated freeze-thaw cycles should be avoided as they can lead to protein degradation and aggregation. It's advisable to conduct stability studies specific to each aq_850 preparation to establish optimal storage conditions for particular research applications.

What quality control measures are essential for verifying recombinant aq_850 integrity?

A multi-faceted approach to quality assessment should include:

  • Purity Assessment:

    • SDS-PAGE with Coomassie or silver staining (target >90% purity)

    • Western blotting using anti-His antibodies

    • A260/A280 ratio to detect nucleic acid contamination

  • Structural Integrity:

    • Circular dichroism spectroscopy to assess secondary structure

    • Dynamic light scattering to detect aggregation

    • Thermal shift assays to evaluate stability

  • Chemical Characterization:

    • Mass spectrometry to confirm molecular weight and modifications

    • N-terminal sequencing for identity confirmation

  • Contaminant Testing:

    • Endotoxin testing (if intended for cellular applications)

    • Host cell protein analysis

These quality control measures ensure experimental results obtained with recombinant aq_850 are reliable and reproducible. Given the thermophilic origin of the protein, thermal stability testing is particularly relevant to confirm proper folding and native-like properties.

What experimental approaches can elucidate the function of uncharacterized protein aq_850?

Elucidating the function of aq_850 requires a multi-disciplinary approach combining computational predictions with experimental validation:

Computational Functional Prediction:

  • Sequence-based approaches:

    • Homology detection using PSI-BLAST, HHpred

    • Conserved domain analysis (CDD, Pfam, InterPro)

    • Evolutionary analysis and phylogenetic profiling

  • Structure-based approaches:

    • Structural modeling using AlphaFold2 or similar tools

    • Structure-function prediction

    • Binding site prediction

Experimental Validation Strategies:

  • Genetic approaches:

    • Heterologous complementation in model organisms

    • Gene knockout/knockdown studies (if genetically tractable)

  • Biochemical approaches:

    • Substrate screening using metabolite arrays

    • Activity-based protein profiling

    • Co-purification of natural binding partners

  • Structural approaches:

    • X-ray crystallography or cryo-EM

    • NMR spectroscopy for dynamics and interactions

  • Systems biology approaches:

    • Transcriptomic profiling under various conditions

    • Protein-protein interaction mapping

This integrated approach maximizes the likelihood of functional discovery by leveraging both computational predictions and diverse experimental techniques. The membrane protein nature of aq_850 should inform experimental design, particularly for structural and interaction studies .

What quasi-experimental designs are appropriate for studying aq_850 function?

For investigating aq_850 function, several quasi-experimental designs are particularly suitable:

  • Untreated Control Group Design with Dependent Pretest and Posttest:

GroupDesign Notation
Intervention GroupO1a X O2a
Control GroupO1b O2b

Where O represents observations and X represents aq_850 expression/presence. This design is ideal for evaluating aq_850's effect on cellular phenotypes or biochemical pathways .

These quasi-experimental approaches accommodate the constraints of biological systems where true randomization may be difficult. They provide structured frameworks for investigating aq_850's effects while controlling for confounding variables and establishing causal relationships .

How can researchers investigate protein-protein interactions involving aq_850?

Investigating protein-protein interactions (PPIs) for aq_850 requires a strategic combination of complementary approaches:

In Vitro PPI Detection Methods:

  • Pull-down assays:

    • Using His-tagged aq_850 as bait

    • Aquifex aeolicus cell lysate as prey

    • Mass spectrometry identification of partners

  • Surface Plasmon Resonance (SPR):

    • For quantitative binding kinetics

    • Requires purified potential interaction partners

  • Crosslinking Mass Spectrometry:

    • For mapping interaction interfaces

    • Uses chemical crosslinkers to stabilize transient interactions

In Vivo PPI Detection Methods:

  • Bacterial two-hybrid system:

    • Adapted for thermophilic proteins if necessary

    • Useful for initial screening of potential interactors

  • Proximity-dependent biotin identification (BioID):

    • Tags proteins in close proximity to aq_850 in vivo

    • Compatible with membrane proteins

Experimental Design Considerations:

  • Include appropriate positive and negative controls

  • Validate interactions through multiple, orthogonal methods

  • Consider the membrane protein nature of aq_850 when designing experiments

  • Account for the thermophilic origin when determining assay conditions

As observed with other Aquifex aeolicus proteins, RNA contamination might occur during purification, potentially complicating interaction studies . RNase treatment during purification steps may be necessary to distinguish true protein-protein interactions from RNA-mediated associations.

How does aq_850 compare structurally to other characterized proteins from Aquifex aeolicus?

Comparative structural analysis between aq_850 and other characterized Aquifex aeolicus proteins can provide valuable insights into potential functional relationships:

Structural Comparison with Known Aquifex aeolicus Proteins:

ProteinStructural FeatureComparative Insight for aq_850
Heme A Synthase (HAS)Forms functional trimers with complex stabilityMay suggest oligomerization potential for aq_850
RNase PMinimal RNA-free form (23 kDa protein)Demonstrates the existence of small, functionally important proteins in A. aeolicus
tRNA (N2,N2-Guanine)-dimethyltransferase (Trm1)RNA binding capabilityPotential RNA interaction properties for aq_850

Key Structural Features to Compare:

  • Thermostability determinants:

    • Distribution of charged residues

    • Hydrogen bonding networks

    • Hydrophobic core packing

  • Membrane interaction surfaces:

    • Hydrophobic patches

    • Charged clusters

  • Functional sites:

    • Cavity and pocket architecture

    • Conserved residue clusters

In the case of Heme A Synthase (HAS) from Aquifex aeolicus, researchers have shown it forms trimers that contribute to complex stability and flexibility . Similar oligomerization tendencies might be present in aq_850, potentially contributing to its function. The study of RNase P in Aquifex aeolicus revealed a minimal 23-kDa protein form, demonstrating that small proteins can perform essential functions in this organism . Comparative analysis can help place aq_850 within this structural and functional landscape.

What research questions can be addressed using recombinant aq_850?

Recombinant aq_850 provides a valuable tool for addressing several fundamental research questions:

  • Structure-Function Relationships in Thermophilic Proteins:

    • How do specific structural features contribute to thermostability?

    • What conformational dynamics characterize proteins from hyperthermophiles?

    • How do membrane proteins from thermophiles achieve proper folding?

  • Evolutionary Biology Questions:

    • How has aq_850 evolved compared to mesophilic homologs?

    • What selective pressures shape protein architecture in thermophiles?

    • Is there evidence for horizontal gene transfer in aq_850 acquisition?

  • Systems Biology Investigations:

    • What is the interactome surrounding aq_850?

    • How does aq_850 expression change under various stress conditions?

    • Does aq_850 contribute to specific adaptive pathways in Aquifex aeolicus?

  • Applied Biotechnology Explorations:

    • Can thermostability principles from aq_850 be applied to protein engineering?

    • Does aq_850 possess properties valuable for biotechnological applications?

These research questions can be addressed using appropriate experimental designs, from basic biochemical and structural studies to more complex systems biology approaches and evolutionary analyses. The hyperthermophilic nature of Aquifex aeolicus (growth optimum near 85°C) makes its proteins particularly interesting for studying adaptations to extreme environments .

How can researchers optimize assay conditions for aq_850 activity testing?

Developing and optimizing assays for an uncharacterized protein like aq_850 requires a systematic approach:

Phase 1: Condition Optimization Matrix
Create a multi-dimensional testing matrix varying the following parameters:

ParameterTesting RangeRationale
Temperature25-95°CReflect both lab conditions and native environment
pH5.0-9.0Cover physiological range and extremes
Salt concentration0-500 mMTest ionic strength effects
Divalent cationsMg²⁺, Ca²⁺, Mn²⁺, Zn²⁺Common cofactors for many enzymes
Detergent typeDDM, LDAO, OG, Triton X-100Essential for membrane protein activity
Reducing agentsDTT, β-ME, TCEPTest redox sensitivity

Phase 2: Activity Detection Strategies

  • Direct activity measurement:

    • Spectrophotometric assays for common enzymatic activities

    • Fluorescence-based detection for sensitive measurements

  • Indirect activity assessment:

    • Thermal shift assays to detect ligand binding

    • Surface plasmon resonance for interaction studies

Phase 3: High-Throughput Screening

  • Substrate screening:

    • Commercial metabolite libraries

    • Nucleotide/nucleoside panels

    • Lipid and membrane component libraries

Special Considerations for Thermophilic Proteins:

  • Equipment adaptation:

    • Temperature-controlled spectrophotometers

    • Thermal cyclers for endpoint assays

  • Control experiments:

    • Include both positive controls (known thermophilic enzymes)

    • Negative controls (heat-inactivated preparations)

This systematic approach maximizes the likelihood of detecting activity by methodically exploring conditions relevant to both the thermophilic origin of aq_850 and its potential functions. For membrane proteins like aq_850, detergent selection is particularly critical for maintaining native-like structure and activity .

What are common challenges in working with recombinant aq_850 and how can they be addressed?

Working with recombinant proteins from hyperthermophilic organisms presents unique challenges:

Challenge 1: Low Expression Yields
Solutions:

  • Codon optimization for E. coli expression

  • Use of specialized expression strains (C41/C43 for membrane proteins)

  • Expression as fusion with solubility enhancers (MBP, SUMO)

  • Induction at lower temperatures (16-18°C) for extended periods

Challenge 2: Protein Aggregation During Purification
Solutions:

  • Detergent screening panel:

    • Test multiple detergent classes (maltosides, glucosides)

    • Optimize detergent concentration

  • Addition of stabilizers:

    • Glycerol (10-20%)

    • Specific lipids

    • Osmolytes (trimethylamine N-oxide, betaine)

Challenge 3: RNA Contamination
As observed with other Aquifex aeolicus proteins, RNA contamination may occur during purification .
Solutions:

  • RNase treatment during purification (RNase A, 10-50 μg/ml)

  • High-salt washes (500 mM - 1 M NaCl) during affinity purification

  • Ion-exchange chromatography to separate protein from nucleic acids

Challenge 4: Stability at Working Temperatures
Solutions:

  • Working temperature optimization:

    • Thermal stability profiling from 20-95°C

    • Identification of minimal working temperature

  • Storage buffer optimization:

    • Addition of specific ions (Ca²⁺, Mg²⁺)

    • pH optimization for stability at lower temperatures

By implementing these methodological solutions, researchers can overcome the common challenges associated with recombinant aq_850 production and characterization. Similar approaches have been successfully applied to other proteins from Aquifex aeolicus .

What controls should be included in experiments involving aq_850?

Proper controls are essential for result interpretation and validation when working with an uncharacterized protein like aq_850:

Expression and Purification Controls:

  • Negative expression control:

    • Empty vector transformation

    • Demonstrates background expression profile

  • Positive expression control:

    • Well-characterized protein from Aquifex aeolicus

    • Validates expression system for thermophilic proteins

Structural and Stability Studies:

  • Denatured protein control:

    • Heat or chemically denatured aq_850

    • Establishes spectroscopic baselines

  • Related protein controls:

    • Other proteins from Aquifex aeolicus

    • Provides context for thermostability profiles

Functional Assays:

  • Enzymatically inactive mutants:

    • Site-directed mutants of predicted catalytic residues

    • Differentiates specific activity from background

  • Heat-inactivated controls:

    • aq_850 heated beyond stability threshold

    • Controls for non-enzymatic effects

Interaction Studies:

  • Non-specific binding controls:

    • Unrelated proteins with similar properties

    • Controls for non-specific interactions

  • Binding site mutants:

    • Mutations in predicted binding interfaces

    • Validates specific interaction sites

Statistical and Experimental Design Controls:

  • Technical replicates:

    • Multiple measurements of the same sample

    • Assesses method precision

  • Biological replicates:

    • Independent preparations of aq_850

    • Accounts for preparation variability

Implementation of this comprehensive control strategy ensures that experimental results with aq_850 can be interpreted with confidence, distinguishing true biological effects from artifacts and providing proper context for observations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.