Recombinant Aquifex aeolicus Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Catalytic Mechanism

The enzyme operates via a two-step mechanism:

  1. Phosphoenzyme formation: H207 attacks the pyrophosphate of C55-PP, releasing inorganic phosphate.

  2. Dephosphorylation: H163 facilitates water-mediated hydrolysis to regenerate C55-P .

StepKey ResiduesRole
Nucleophilic attackH30, E17, E21, R174Coordinate Mg²⁺ ions, stabilize transition states, and bind substrate
HydrolysisH163, R104, R201Position water molecule for phosphate release

Recombinant Production and Purification

Recombinant uppP is produced via:

  • Cloning: uppP gene inserted into E. coli expression vectors.

  • Purification: Nickel affinity chromatography (His-tag), followed by size-exclusion chromatography .

ParameterDetail
Expression yield~1–2 mg/L culture
Purity>85% (SDS-PAGE analysis)
Storage-20°C in Tris-based buffer with 50% glycerol

Research Insights and Mutational Studies

Mutagenesis in homologs (e.g., Micrococcus luteus) revealed:

  • Asn-77: Critical for catalysis; substitutions (Ala, Asp, Gln) abolishes activity .

  • Trp-78: Modulates substrate binding; substitutions (Ile, Arg, Asp) increase Kₘ for farnesyl diphosphate 5–20-fold .

MutationEffect on ActivitySubstrate Affinity (FPP)
N77ADrastic loss of activityUnchanged
W78IModerate activity, Kₘ ↑ 5-foldReduced binding
W78DModerate activity, Kₘ ↑ 20-foldReduced binding

Applications in Research and Biotechnology

ApplicationRelevance
Antibiotic targetBacitracin inhibits C55-P regeneration; uppP is a potential drug target
Structural biologyThermophilic stability aids X-ray crystallography studies
Peptidoglycan researchModel for understanding lipid carrier recycling in Gram-positive bacteria

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them in your order remarks. We will strive to accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributors.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquotting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of that specific tag.
Synonyms
uppP; bacA; upk; aq_2195; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Aquifex aeolicus (strain VF5)
Target Names
uppP
Target Protein Sequence
MTEWQAVVLGIVEGISEFLPISSTGHLILTAHILGIKHTDFVKSFEISIQLGSILAVVVL YFNRLIRDYEIWKRIIAAFIPTGIIGFLLYKLIKGFLIGNDLVVVVSLILGGIILIFADT YCEKFCYLGDVRELPLRKAFMIGVFQSIAVIPGVSRSGSTIIGGMLMGLNRKVAAEFSFL LAIPTMFAATTYDLIKSGGSFNAQEWNILIIGFITSFITALIVVKWFLNFLKSHSLKIFG FYRILIGLVYAAFFLF
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: aae:aq_2195

STRING: 224324.aq_2195

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its biological function?

Undecaprenyl-diphosphatase (EC 3.6.1.27), also known as BacA or Undecaprenyl pyrophosphate phosphatase, is an enzyme that catalyzes the dephosphorylation of undecaprenyl diphosphate to undecaprenyl phosphate:

undecaprenyl diphosphate + H₂O → undecaprenyl phosphate + phosphate

This reaction is critical in bacterial cell wall peptidoglycan biosynthesis. The enzyme participates in the lipid carrier cycle that is essential for transporting peptidoglycan precursors across the bacterial cell membrane during cell wall assembly. Additionally, this enzyme has been implicated in conferring resistance to the antibiotic bacitracin .

Why is Aquifex aeolicus Undecaprenyl-diphosphatase of particular interest to researchers?

Aquifex aeolicus is a hyperthermophilic bacterium with optimal growth at around 85°C, making its enzymes particularly stable at high temperatures. This thermostability offers significant advantages for structural and biochemical studies. The Undecaprenyl-diphosphatase from A. aeolicus provides a robust model system for studying membrane protein function and bacterial cell wall biosynthesis. Additionally, since this enzyme is involved in antibiotic resistance mechanisms, understanding its structure and function could contribute to the development of new antimicrobial strategies targeting cell wall biosynthesis .

How does uppP differ structurally and functionally from similar enzymes in other bacterial species?

While the core catalytic function of undecaprenyl-diphosphatase is conserved across bacterial species, there are notable differences in structure and substrate specificity:

  • Sequence comparison across different bacterial species reveals several highly conserved regions, including characteristic motifs essential for catalysis .

  • Unlike other bacterial prenyl transferases, the A. aeolicus uppP has specific adaptations for functioning in extreme temperatures.

  • The binding affinity for substrates varies between species. For instance, comparative binding studies show that some homologous proteins (like UptA from B. subtilis) have significantly different binding affinities for undecaprenyl phosphate (C55-P) versus undecaprenyl diphosphate (C55-PP) .

What are the optimal conditions for expressing recombinant Aquifex aeolicus Undecaprenyl-diphosphatase in E. coli?

For optimal expression of recombinant A. aeolicus uppP in E. coli, the following conditions are recommended:

  • Expression System: E. coli BL21(DE3) strain is typically used for high-level expression of recombinant proteins .

  • Vector Selection: Use vectors with strong promoters like T7 and include appropriate tags (His-tag) for purification.

  • Growth Conditions:

    • Culture medium: LB or 2× YT with appropriate antibiotics

    • Growth temperature: 37°C until OD600 reaches 0.6-0.8

    • Induction: 0.5-1 mM IPTG

    • Post-induction temperature: Reduce to 25-30°C for 4-6 hours to enhance soluble protein production

  • Buffer Composition: Include glycerol (10%) and mild detergents (0.01% Triton X-100) in buffers to maintain protein solubility .

  • Induction Protocol: For membrane proteins like uppP, slower induction at lower temperatures often yields better results in terms of correctly folded protein.

What purification strategies are most effective for obtaining high-quality Recombinant Aquifex aeolicus uppP?

Purification of recombinant A. aeolicus uppP typically involves the following steps:

  • Cell Lysis: Use sonication or mechanical disruption in a buffer containing 20 mM Tris-HCl (pH 8.0), 150 mM NaCl, 1 mM EDTA, 10% glycerol, and protease inhibitors.

  • Membrane Fraction Isolation: Since uppP is a membrane protein, ultracentrifugation (100,000 × g for 1 hour) is required to isolate the membrane fraction.

  • Solubilization: Solubilize the membrane fraction using detergents such as n-dodecyl-β-D-maltoside (DDM) or Triton X-100.

  • Affinity Chromatography: If the protein is His-tagged, use immobilized metal affinity chromatography (IMAC) with Ni-NTA resin. The protocol typically includes:

    • Equilibration buffer: 20 mM Tris-HCl (pH 8.0), 300 mM NaCl, 0.05% detergent, 10 mM imidazole

    • Wash buffer: Same as equilibration with 20-50 mM imidazole

    • Elution buffer: Same as wash with 250-500 mM imidazole

  • Further Purification: Size exclusion chromatography using a HiLoad Superdex 200 column can be used to achieve higher purity and to assess oligomeric state.

  • Storage: Store the purified protein in a buffer containing 50% glycerol at -20°C for short-term or -80°C for long-term storage .

How can I assess the enzymatic activity of recombinant uppP?

The enzymatic activity of uppP can be assessed using several complementary approaches:

  • Spectrophotometric Assay:

    • A continuous assay using 2-amino-6-mercapto-7-methylpurine ribonucleoside (MESG) to monitor phosphate release

    • Reaction conditions: 20 mM Tris-HCl (pH 7.5), 1 mM MgCl₂, 0.01% v/v Triton X-100, undecaprenyl diphosphate as substrate

    • Monitor absorbance at 360 nm

  • Radiometric Assay:

    • Using [³H]-labeled substrates to directly measure product formation

    • Separate products by thin-layer chromatography (TLC)

    • Quantify radioactivity by scintillation counting

  • Coupled Enzymatic Assay:

    • Use inorganic pyrophosphatase to convert released pyrophosphate to phosphate

    • Detect phosphate using malachite green (measure absorbance at 660 nm)

    • Reaction mixture: 100 mM Tris-HCl (pH 7.5), 0.2 mM MgCl₂, undecaprenyl diphosphate, and 0.003 U of inorganic pyrophosphatase

  • Native Mass Spectrometry:

    • Can be used to directly observe enzyme-substrate complexes and determine binding affinities

    • Particularly useful for comparing binding of different substrates (e.g., C55-P vs. C55-PP)

What key residues are critical for the catalytic function of Aquifex aeolicus uppP?

Based on mutational studies and sequence conservation analysis of uppP across bacterial species, several key residues have been identified as critical for enzymatic function:

  • Conserved Asparagine and Tryptophan: Residues Asn-77 and Trp-78 play crucial roles in catalysis. Mutational studies have shown that substitution of Asn-77 with Ala, Asp, or Gln results in dramatic reduction of enzymatic activity. Mutations of Trp-78 also significantly impact function .

  • Arginine Residues: In related enzymes like UptA, arginine residues (particularly R112 and R118) form part of a hydrogen bonding network essential for substrate binding. Double mutants R112A/R118A show approximately 43% reduction in substrate binding compared to wild type .

  • Metal-Binding Residues: Divalent cations, particularly Ca²⁺, enhance the enzymatic activity of uppP. Residues involved in coordinating these metal ions are essential for optimal catalysis .

  • Hydrophobic Residues: Several hydrophobic amino acids lining the substrate binding pocket facilitate interaction with the lipid chain of undecaprenyl diphosphate.

How does uppP interact with lipid substrates and what are the binding determinants?

The interaction between uppP and its lipid substrates involves several molecular determinants:

  • Substrate Preference: Studies on related enzymes show higher binding affinity for undecaprenyl phosphate (C55-P) compared to undecaprenyl diphosphate (C55-PP). For instance, UptA from B. subtilis shows an apparent Kd of 5.7±0.7 μM for C55-P versus 15.3 μM for C55-PP, indicating preferential binding to the phosphate form .

  • Competition Studies: Native mass spectrometry experiments have demonstrated that undecaprenyl phosphate can effectively displace phospholipids bound to the enzyme, while phospholipids cannot significantly displace bound undecaprenyl phosphate, suggesting a stronger and more specific interaction with the lipid carrier .

  • Key Binding Interactions: The enzyme forms extensive contacts with both the phosphate/diphosphate head group and the hydrophobic lipid tail. The diphosphate moiety interacts with positively charged amino acids, while the lipid chain is stabilized through hydrophobic interactions with non-polar residues .

  • Chain Length Specificity: The enzyme shows a preference for the native C55 chain length compared to shorter analogs, indicating that the hydrophobic binding pocket is optimized for the full-length undecaprenyl chain .

What is the relationship between uppP and antibiotic resistance?

Undecaprenyl-diphosphatase plays a significant role in antibiotic resistance, particularly against drugs targeting bacterial cell wall biosynthesis:

  • Bacitracin Resistance: uppP (also known as BacA) confers resistance to bacitracin, an antibiotic that binds to undecaprenyl pyrophosphate and prevents its dephosphorylation, thereby inhibiting cell wall synthesis. By catalyzing the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, uppP effectively competes with bacitracin and maintains cell wall synthesis .

  • Potential Therapeutic Target: Due to its critical role in peptidoglycan biosynthesis, uppP represents a potential target for new antibacterial agents. Inhibitors of uppP could disrupt cell wall formation and potentially synergize with existing antibiotics like methicillin and vancomycin to combat resistant strains such as MRSA and VRE .

  • Inhibitor Development: Recent studies have identified several classes of uppP inhibitors, including rhodanines, dihydroxyphenyls, and pyrimidinetriones, that show promising antibacterial activity against Gram-positive bacteria, including drug-resistant strains .

What methods can be used to study the membrane integration and topology of Aquifex aeolicus uppP?

Investigating the membrane integration and topology of membrane proteins like A. aeolicus uppP requires specialized approaches:

  • Cysteine Scanning Mutagenesis:

    • Systematically replace residues with cysteine and determine accessibility to membrane-impermeable thiol-reactive reagents

    • This approach can map regions exposed to either side of the membrane

  • Fusion Protein Approach:

    • Create fusions with reporter proteins like alkaline phosphatase or green fluorescent protein

    • The activity or fluorescence of the reporter indicates the membrane orientation

  • Protease Protection Assays:

    • Treat membrane vesicles with proteases

    • Protected fragments represent transmembrane or intravesicular domains

    • Analyze by SDS-PAGE and immunoblotting

  • Cryo-Electron Microscopy:

    • Provides high-resolution structural information in a near-native lipid environment

    • Can reveal membrane integration details without crystallization

  • Molecular Dynamics Simulations:

    • Predict protein-membrane interactions and stable conformations

    • Provides dynamic information about protein behavior in membranes

How can I optimize experimental conditions for structural studies of Aquifex aeolicus uppP?

Structural studies of membrane proteins like uppP present unique challenges. Here are approaches to optimize experimental conditions:

  • Crystallization Optimization:

    • Screen various detergents (DDM, LDAO, LMNG) for protein extraction and stability

    • Use lipidic cubic phase (LCP) crystallization for membrane proteins

    • Include specific lipids that might be required for structural integrity

    • Consider adding substrate analogs or inhibitors to stabilize specific conformations

  • Protein Engineering for Structural Studies:

    • Introduce thermostabilizing mutations identified through scanning mutagenesis

    • Create fusion constructs with crystallization chaperones like T4 lysozyme

    • Remove flexible regions that might hinder crystallization

    • Consider antibody fragment co-crystallization to provide crystal contacts

  • NMR Sample Preparation:

    • Isotopic labeling (¹⁵N, ¹³C) for multidimensional NMR studies

    • Deuteration to reduce spectral complexity

    • Reconstitution in nanodiscs or bicelles to provide a native-like membrane environment

  • Cryo-EM Sample Preparation:

    • Optimize protein concentration (typically 0.5-5 mg/mL)

    • Screen different grid types and freezing conditions

    • Consider using antibodies or nanobodies to increase particle size

    • Reconstitution in nanodiscs can improve particle orientation distribution

What are the considerations for designing inhibitor studies targeting Aquifex aeolicus uppP?

When designing inhibitor studies for A. aeolicus uppP, several aspects should be considered:

  • Rational Design Approach:

    • Utilize structural information about the enzyme's active site

    • Focus on compounds that can interact with key catalytic residues (like Asn-77 and Trp-78)

    • Consider the physicochemical properties needed for membrane penetration

    • Design compounds that mimic the transition state of the dephosphorylation reaction

  • High-Throughput Screening Setup:

    • Develop robust and scalable enzymatic assays for screening compound libraries

    • Use fluorescence-based or colorimetric assays that can be adapted to 384-well format

    • Include appropriate controls to identify false positives due to compound interference

    • Consider counter-screening against human phosphatases to assess selectivity

  • Structure-Activity Relationship (SAR) Studies:

    • Systematically modify promising scaffolds to improve potency and selectivity

    • Analyze binding mode through computational docking and crystallography

    • Balance hydrophobicity required for membrane penetration with aqueous solubility

    • Optimize pharmacokinetic properties alongside enzyme inhibition

  • Evaluation in Biological Systems:

    • Test inhibitors against purified enzyme and in bacterial growth assays

    • Assess activity against various bacterial species including drug-resistant strains

    • Determine minimum inhibitory concentrations (MICs) and bactericidal vs. bacteriostatic effects

    • Investigate synergistic effects with existing antibiotics targeting cell wall synthesis

How can I investigate the role of uppP in bacterial cell wall synthesis using genetic approaches?

Genetic approaches provide powerful tools to understand uppP function in bacterial cell wall synthesis:

  • Conditional Knockdown/Knockout Strategies:

    • Generate temperature-sensitive mutants or use inducible promoters to control expression

    • CRISPR-Cas9 genome editing for precise gene manipulation

    • Analyze phenotypic consequences including morphological changes, growth defects, and antibiotic sensitivity

  • Complementation Studies:

    • Express wild-type or mutant versions of uppP in knockout strains

    • Determine which mutations can restore function and which cannot

    • Cross-species complementation to assess functional conservation

  • Suppressor Mutation Analysis:

    • Identify mutations in other genes that can compensate for uppP defects

    • Can reveal functional interactions and redundant pathways

    • Whole-genome sequencing to identify spontaneous suppressor mutations

  • Reporter Gene Fusions:

    • Create transcriptional or translational fusions to monitor expression patterns

    • Study regulation under different growth conditions and stresses

    • Visualize localization patterns within the cell

How can I improve the solubility and stability of recombinant Aquifex aeolicus uppP?

Membrane proteins like uppP often present solubility and stability challenges. Here are strategies to address these issues:

  • Optimizing Expression Conditions:

    • Lower induction temperature (16-25°C) to slow protein folding

    • Reduce inducer concentration for more gradual expression

    • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

    • Use specialized E. coli strains designed for membrane protein expression (C41, C43)

  • Buffer Optimization:

    • Screen different pH ranges (typically pH 7.0-8.5)

    • Test various salt concentrations (100-500 mM NaCl)

    • Include stabilizing agents: glycerol (10-20%), specific lipids, and reducing agents

    • Add specific metal ions that might be cofactors (e.g., Mg²⁺, Ca²⁺)

  • Detergent Selection:

    DetergentCMC (mM)MWComments for uppP
    DDM0.17511Good initial choice, mild
    LMNG0.011,005Improved stability over DDM
    LDAO1-2229Harsh but effective for some applications
    Triton X-1000.2-0.9625Used in activity assays
    Digitonin0.51,229Gentle, good for preserving complexes
  • Protein Engineering Approaches:

    • Remove flexible termini that might contribute to aggregation

    • Introduce surface mutations to enhance solubility

    • Consider fusion tags beyond His-tag (MBP, SUMO) that can enhance solubility

What are common pitfalls in enzymatic assays for uppP and how can they be addressed?

Several issues can affect the reliability of uppP enzymatic assays:

  • Background Phosphate Contamination:

    • Use high-purity reagents and water

    • Include appropriate blanks and controls

    • Consider pre-treating solutions with activated charcoal to remove phosphate

  • Detergent Interference:

    • Some detergents can affect spectrophotometric readings

    • Optimize detergent concentration (typically 0.01-0.05%)

    • Validate assay linearity in the presence of detergent

    • Ensure consistent detergent concentration across all samples and standards

  • Substrate Solubility Issues:

    • Undecaprenyl diphosphate has limited solubility in aqueous buffers

    • Prepare fresh substrate solutions or store properly to prevent aggregation

    • Consider using substrate analogs with better solubility for initial screening

  • Enzyme Stability During Assay:

    • Monitor activity over time to ensure enzyme stability

    • Optimize protein concentration and reaction time

    • Include stabilizing agents in the reaction buffer

    • Consider temperature effects, especially for thermophilic enzymes like A. aeolicus uppP

How do I interpret discrepancies between in vitro activity and in vivo function of uppP?

Discrepancies between in vitro and in vivo results are common when studying membrane proteins like uppP. Here's how to interpret and address such differences:

  • Membrane Environment Effects:

    • The detergent-solubilized state may not fully recapitulate the native membrane environment

    • Consider reconstitution in liposomes or nanodiscs for more physiologically relevant assays

    • Test activity in the presence of specific lipids found in bacterial membranes

  • Protein-Protein Interactions:

    • uppP may interact with other proteins in vivo that affect its function

    • Identify potential interaction partners through pull-down assays or crosslinking

    • Co-express with putative partners to assess functional changes

  • Substrate Accessibility:

    • The concentration and presentation of substrate may differ between in vitro and in vivo conditions

    • Consider how substrate is delivered to the enzyme in the cellular context

    • Develop assays that better mimic the physiological substrate presentation

  • Integrated System Effects:

    • Cell wall biosynthesis involves multiple enzymes working in concert

    • Study uppP in the context of the entire pathway when possible

    • Use cell-based assays to complement purified enzyme studies

What emerging technologies could advance our understanding of uppP function and applications?

Several cutting-edge technologies hold promise for deepening our understanding of uppP:

  • Single-Molecule Techniques:

    • Single-molecule FRET to observe conformational changes during catalysis

    • Atomic force microscopy to study protein-membrane interactions

    • Optical tweezers to measure forces involved in substrate processing

  • Advanced Structural Methods:

    • Micro-electron diffraction (MicroED) for structure determination from nanocrystals

    • Time-resolved crystallography to capture catalytic intermediates

    • Integrative structural biology combining multiple data sources (cryo-EM, NMR, SAXS)

  • Systems Biology Approaches:

    • Multi-omics integration to understand uppP in the broader context of bacterial physiology

    • Metabolic flux analysis to quantify the impact of uppP activity on cell wall synthesis

    • Network analysis to identify critical nodes in peptidoglycan synthesis pathways

  • Synthetic Biology Applications:

    • Engineer bacteria with modified uppP for enhanced antibiotic production or resistance

    • Develop biosensors based on uppP function for screening antimicrobial compounds

    • Create minimal cell systems to study essential functions of uppP

How might research on thermophilic Aquifex aeolicus uppP contribute to industrial applications?

The thermostable nature of A. aeolicus uppP offers several potential industrial applications:

  • Biocatalysis Under Extreme Conditions:

    • Development of enzymatic processes requiring high temperature stability

    • Creation of chimeric enzymes incorporating thermostable domains

    • Use in multi-enzymatic reaction cascades requiring diverse conditions

  • Biosensor Development:

    • Thermostable biosensors for detection of phosphate or related compounds

    • Environmental monitoring applications in high-temperature settings

    • Long-shelf-life diagnostic tools based on enzyme activity

  • Pharmaceutical Applications:

    • Structure-based drug design targeting homologous enzymes in pathogens

    • Development of new antibiotics targeting bacterial cell wall synthesis

    • Creation of enzyme inhibitors as research tools to study cell wall assembly

  • Protein Engineering Templates:

    • Use thermostable scaffold for engineering novel enzymatic activities

    • Study protein folding and stability principles for improving other enzymes

    • Develop guidelines for enhancing thermal stability of industrial enzymes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.