Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_471923 (ARALYDRAFT_471923)

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Properties

The protein exhibits the following key features:

PropertyDetails
Species OriginArabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)
Expression SystemEscherichia coli
TagN-terminal His tag
Protein Length204 amino acids
Amino Acid SequenceMEKSNDHDKASHGGSGGGATEKWEETSPGIRTAETMLRLAPVGLCVAALVVMLKDSETNEFGSISYSNLTAFRYLVHANGICAGYSLLSAAIAAMPRSSSTMPRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGDSAITWSDACSSYGGFCHRATASVIITFFVVCFYILLSLISSYKLFTRFDPPSIVDSDKTLEVAVFGS
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) at -20°C/-80°C

Comparative studies of CASP proteins in Arabidopsis and rice reveal molecular weights ranging from 16–32 kDa, with theoretical isoelectric points (pI) between 4.2–10.22 . While specific functional data for ARALYDRAFT_471923 is limited, CASP-like proteins generally localize to cell membranes and contribute to Casparian strip formation, which regulates nutrient transport in plant roots .

2.1. CASP Gene Family and Motif Analysis

ARALYDRAFT_471923 belongs to the CASPL (CASP-like) subgroup, part of the larger MARVEL protein family conserved across land plants and green algae . Key findings include:

  • Conserved domains: Transmembrane domains (TM1 and TM3) with conserved Arg (TM1) and Asp (TM3) residues critical for structural integrity .

  • Motif composition: Motifs 3, 4, 6, and 8 are common across CASPs, while Motif 7 is absent in Arabidopsis, suggesting functional divergence from rice homologs .

2.2. Hormone-Responsive Elements

Genomic analysis of CASP genes identifies hormone-responsive promoter elements, including:

  • Abscisic acid (ABRE)

  • Ethylene (ERE)

  • Methyl jasmonate (CGTCA/TGACG motifs) .
    These elements imply regulatory roles in stress responses, though ARALYDRAFT_471923’s specific interactions remain uncharacterized.

Research Applications

This recombinant protein is utilized in:

  • ELISA assays: For quantifying CASP-like protein expression under experimental conditions .

  • Structural studies: Full-length sequence enables investigations into transmembrane domain organization and ligand-binding properties .

  • Comparative genomics: Serves as a reference for studying CASP evolution in Brassicaceae species .

Limitations and Future Directions

Current gaps include:

  • Lack of explicit functional data (e.g., enzymatic activity or interaction partners).

  • Unresolved tertiary structure and membrane integration mechanisms.
    Future studies could employ cryo-EM or yeast two-hybrid systems to elucidate its role in Arabidopsis lyrata physiology .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ARALYDRAFT_471923; CASP-like protein 2A1; AlCASPL2A1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)
Target Names
ARALYDRAFT_471923
Target Protein Sequence
MEKSNDHDKASHGGSGGGATEKWEETSPGIRTAETMLRLAPVGLCVAALVVMLKDSETNE FGSISYSNLTAFRYLVHANGICAGYSLLSAAIAAMPRSSSTMPRVWTFFCLDQLLTYLVL AAGAVSAEVLYLAYNGDSAITWSDACSSYGGFCHRATASVIITFFVVCFYILLSLISSYK LFTRFDPPSIVDSDKTLEVAVFGS
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the CASP-like protein ARALYDRAFT_471923?

CASP-like protein ARALYDRAFT_471923 is a full-length protein (204 amino acids) from Arabidopsis lyrata subsp. lyrata, commonly known as Lyre-leaved rock-cress. It belongs to the CASP (Casparian strip membrane domain proteins) family, which plays crucial roles in the formation of Casparian strips in plants. The protein is also known by other synonyms including CASP-like protein 2A1 and AlCASPL2A1, as indicated in current protein databases. CASP-like proteins are generally characterized as integral membrane proteins that participate in the development of diffusion barriers in plant tissues. The ARALYDRAFT_471923 protein has a UniProt ID of D7KFC7, which can be used to access additional information in protein databases and related resources .

What is the amino acid sequence and structural characteristics of ARALYDRAFT_471923?

The full amino acid sequence of ARALYDRAFT_471923 consists of 204 amino acids and is as follows: MEKSNDHDKASHGGSGGGATEKWEETSPGIRTAETMLRLAPVGLCVAALVVMLKDSETNEFGSISYSNLTAFRYLVHANGICAGYSLLSAAIAAMPRSSSTMPRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGDSAITWSDACSSYGGFCHRATASVIITFFVVCFYILLSLISSYKLFTRFDPPSIVDSDKTLEVAVFGS . Analysis of this sequence reveals several hydrophobic regions that are characteristic of membrane-spanning domains, which is consistent with its classification as an integral membrane protein. Secondary structure prediction suggests a mix of alpha-helical transmembrane segments interspersed with loop regions that likely protrude into either the cytoplasm or extracellular space. The protein lacks obvious enzymatic domains but contains conserved motifs found in other CASP family members that are believed to be important for protein-protein interactions during the assembly of membrane barriers. Understanding these structural features is essential for designing experiments to probe function and for developing strategies to express and purify the protein in its native conformation.

How does ARALYDRAFT_471923 compare to other CASP-like proteins in Arabidopsis and related species?

Comparative analysis of ARALYDRAFT_471923 with other CASP-like proteins reveals both conservation and divergence across species. In Arabidopsis thaliana, the closest homolog is CASP-like protein At3g06390 (AtCASPL1D2), which shares significant sequence similarity and likely similar functional roles . Another related protein in Arabidopsis lyrata is CASP-like protein ARALYDRAFT_477942, which is characterized as an integral membrane family protein and may participate in similar physiological processes . Outside of the Arabidopsis genus, Glycine max (soybean) contains CASP-like protein 7, also known as CASP-like protein 1D2, which represents an evolutionary adaptation of this protein family in legumes .

Phylogenetic analysis of these proteins suggests that CASP-like proteins evolved from a common ancestor and subsequently diversified to perform specialized functions in different plant tissues and species. Conservation patterns in the amino acid sequences indicate functionally important regions that have been maintained through evolutionary pressure. The transmembrane domains show higher conservation than the loop regions, suggesting that membrane integration is crucial for the protein's function. This comparative approach provides insights into the potential roles of ARALYDRAFT_471923 based on the better-characterized functions of its homologs in model organisms.

What are the optimal expression systems for recombinant ARALYDRAFT_471923 production?

The recombinant ARALYDRAFT_471923 protein can be successfully expressed in several systems, with E. coli being the most commonly documented host . When expressed in E. coli, the protein is typically fused to an N-terminal His-tag to facilitate purification and detection. The choice of expression system should be guided by the specific research objectives and downstream applications. For basic biochemical and structural studies, bacterial expression offers high yields and cost-effectiveness, but may not provide post-translational modifications that might be present in the native protein. For studies requiring authentic post-translational modifications, alternative expression systems such as yeast, baculovirus-infected insect cells, or mammalian cell cultures should be considered.

Cell-free expression systems represent another viable option, especially for membrane proteins like ARALYDRAFT_471923 that may be toxic when overexpressed in living cells. These systems allow for direct manipulation of the translation environment and can incorporate detergents or lipids during protein synthesis to maintain proper folding of membrane proteins. Regardless of the chosen system, optimization of expression conditions is crucial, including parameters such as temperature, inducer concentration, and duration of expression. Comparative studies using different expression vectors, promoter strengths, and fusion tags may be necessary to identify conditions that yield the highest amount of correctly folded protein.

What purification strategies yield the highest purity and activity for ARALYDRAFT_471923?

Purification of recombinant ARALYDRAFT_471923 typically begins with affinity chromatography, leveraging the His-tag fused to the protein. This approach allows for selective capture of the target protein from the complex mixture of cellular components. Following initial capture, additional purification steps are often necessary to achieve high purity (>90% as determined by SDS-PAGE) . Size exclusion chromatography can separate the target protein from aggregates and smaller contaminants based on molecular size. Ion exchange chromatography may further remove impurities with different charge properties at a given pH.

The choice of detergents is critical when working with membrane proteins like ARALYDRAFT_471923. Mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin often provide a good balance between efficient extraction and preservation of protein structure and function. A systematic approach to detergent screening is recommended to identify optimal conditions. During the purification process, monitoring protein stability and homogeneity using techniques such as dynamic light scattering or analytical ultracentrifugation can provide valuable feedback for method optimization. The final preparation should be assessed not only for purity by SDS-PAGE but also for proper folding using circular dichroism or fluorescence spectroscopy, and for functionality using appropriate activity assays.

What are the recommended storage conditions to maintain ARALYDRAFT_471923 stability?

Proper storage of purified ARALYDRAFT_471923 is crucial for maintaining its stability and activity over time. The protein is typically supplied as a lyophilized powder, which offers greater stability during shipping and long-term storage . For short-term storage of the lyophilized product, keeping the vial at -20°C is sufficient, while long-term storage is recommended at -80°C. It is important to protect the protein from moisture and to minimize freeze-thaw cycles, as these can lead to denaturation and loss of activity.

Once reconstituted, the protein should be stored at 4°C for short-term use (up to one week) or aliquoted and stored at -20°C/-80°C for longer periods . The addition of glycerol (typically 5-50% final concentration) is recommended to prevent damage from ice crystal formation during freezing. The standard protocol suggests a final glycerol concentration of 50% for optimal protection . Additionally, the choice of buffer can significantly impact protein stability. The protein is supplied in a Tris/PBS-based buffer at pH 8.0 with 6% trehalose, which acts as a cryoprotectant and stabilizer . When designing storage conditions for specific experiments, it may be beneficial to include additives such as reducing agents (e.g., DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues, or protease inhibitors to prevent degradation by contaminating proteases.

How can researchers effectively reconstitute ARALYDRAFT_471923 for functional studies?

For optimal reconstitution of lyophilized ARALYDRAFT_471923, researchers should first centrifuge the vial briefly to ensure all contents are at the bottom before opening. The protein should be reconstituted in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL . This concentration range balances the need for sufficient protein for experiments while avoiding conditions that might promote aggregation. The reconstitution process should be gentle to minimize protein denaturation, typically involving careful addition of the reconstitution buffer followed by gentle swirling or slow rotation rather than vigorous mixing or vortexing.

For membrane proteins like ARALYDRAFT_471923, reconstitution into a lipid environment may be necessary to study native function. This can be accomplished using detergent-mediated reconstitution into liposomes or nanodiscs. The choice of lipid composition should reflect the native membrane environment of the protein when possible. For functional studies, it may be necessary to remove the His-tag using a specific protease (e.g., TEV protease) if the tag interferes with protein activity or interaction studies. Following reconstitution, it is advisable to analyze a small aliquot by SDS-PAGE or Western blotting to confirm protein integrity before proceeding with functional assays. For experiments requiring precise protein concentrations, methods such as BCA assay or UV absorbance at 280 nm can be used, taking into account the protein's extinction coefficient calculated from its amino acid composition.

What techniques are most effective for studying ARALYDRAFT_471923 interactions with other proteins?

Investigating protein-protein interactions involving ARALYDRAFT_471923 requires techniques suitable for membrane proteins. Co-immunoprecipitation (Co-IP) using antibodies against the His-tag or against specific protein partners can identify stable interactions. This approach can be complemented with Western blotting using antibodies such as the rabbit anti-Arabidopsis thaliana At3g06390 polyclonal antibody, which might cross-react with ARALYDRAFT_471923 due to sequence similarity . For discovering novel interaction partners, proximity-dependent biotin identification (BioID) or APEX2-based proximity labeling offer advantages for membrane proteins by identifying nearby proteins in the native cellular environment.

Surface plasmon resonance (SPR) and microscale thermophoresis (MST) provide quantitative measurements of binding affinities between ARALYDRAFT_471923 and potential interaction partners. These techniques require careful consideration of detergent or lipid conditions to maintain protein stability. For structural characterization of protein complexes, cryo-electron microscopy has emerged as a powerful tool for membrane proteins, potentially revealing the three-dimensional organization of ARALYDRAFT_471923 with its binding partners. Complementary computational approaches, such as molecular docking and molecular dynamics simulations, can generate hypotheses about interaction interfaces that can be tested experimentally. When designing interaction studies, it is important to consider controls for non-specific binding, especially when working with detergent-solubilized membrane proteins.

How can researchers assess the membrane integration and topology of ARALYDRAFT_471923?

Understanding the membrane topology of ARALYDRAFT_471923 is essential for interpreting its function. Computational prediction tools can provide initial topology models based on the amino acid sequence, identifying potential transmembrane domains, cytoplasmic loops, and extracellular regions. These predictions should be experimentally validated using techniques such as cysteine scanning mutagenesis coupled with accessibility assays. In this approach, individual cysteine residues are introduced at various positions, and their accessibility to membrane-impermeable sulfhydryl reagents indicates whether they are exposed to the aqueous environment or buried within the membrane or protein core.

Protease protection assays offer another approach to topology mapping, where the accessibility of specific sites to proteases is determined in the presence of intact membranes. Limited proteolysis followed by mass spectrometry can identify exposed regions and domain boundaries. For more detailed structural information, techniques such as hydrogen-deuterium exchange mass spectrometry can map solvent-accessible regions of the protein. When expressing ARALYDRAFT_471923 in heterologous systems, fusion of reporter tags (such as GFP or epitope tags) at various positions can help determine their localization relative to the membrane when combined with techniques like fluorescence microscopy or selective permeabilization of membranes. Integration of data from multiple complementary approaches provides the most reliable topology model.

What are the current hypotheses regarding the physiological role of ARALYDRAFT_471923 in Arabidopsis lyrata?

Based on its classification as a CASP-like protein, ARALYDRAFT_471923 likely participates in the formation of diffusion barriers in plant tissues, particularly Casparian strips in the endodermis. CASP proteins are known to function as scaffolds that recruit the lignin polymerization machinery to specific membrane domains, thereby creating precisely localized cell wall modifications. Given its specific expression pattern and evolutionary conservation, ARALYDRAFT_471923 may play specialized roles in particular tissues or developmental stages of Arabidopsis lyrata. Comparative studies with related proteins like ARALYDRAFT_477942 (another CASP-like protein in A. lyrata) and At3g06390 (the A. thaliana homolog) provide context for understanding its unique functions .

Research using knockout or knockdown approaches in model systems could help elucidate the specific physiological consequences of ARALYDRAFT_471923 deficiency. Phenotypic analyses focusing on plant development, stress responses, and nutrient transport would be particularly informative. Transcriptomic and proteomic profiling of plants with altered ARALYDRAFT_471923 expression could reveal affected pathways and processes, providing clues to its physiological role. Localization studies using fluorescently tagged versions of the protein would identify its subcellular distribution and tissue-specific expression patterns. Additionally, comparing wild-type plants with those expressing modified versions of ARALYDRAFT_471923 could help identify critical functional domains and residues, furthering our understanding of its mechanism of action in plant physiology.

How can structural biology approaches be applied to study ARALYDRAFT_471923?

Structural biology approaches offer powerful insights into ARALYDRAFT_471923 function, though membrane proteins present unique challenges. X-ray crystallography requires obtaining diffraction-quality crystals, which for membrane proteins often involves crystallization in lipidic cubic phases or with the help of antibody fragments to increase polar surface area. Nuclear magnetic resonance (NMR) spectroscopy can provide structural information in solution, particularly for smaller domains or fragments of the protein. For both techniques, isotopic labeling (15N, 13C, 2H) may be necessary, requiring expression in minimal media with controlled isotope sources.

What are the most promising approaches for studying post-translational modifications of ARALYDRAFT_471923?

Investigation of post-translational modifications (PTMs) in ARALYDRAFT_471923 requires sensitive analytical techniques. Mass spectrometry-based proteomics offers the most comprehensive approach, with techniques such as liquid chromatography-tandem mass spectrometry (LC-MS/MS) enabling identification of multiple types of PTMs. Sample preparation is crucial, often involving enrichment strategies specific to the modification of interest, such as phosphopeptide enrichment using titanium dioxide (TiO2) or metal oxide affinity chromatography (MOAC) for phosphorylation studies. For glycosylation analysis, lectin affinity chromatography or hydrazide chemistry can enrich glycopeptides prior to MS analysis.

Western blotting with modification-specific antibodies (e.g., anti-phosphotyrosine, anti-phosphoserine) provides a targeted approach for detecting specific PTMs. This can be complemented with enzymatic treatments (e.g., phosphatases, glycosidases) to confirm the nature of the modification. Site-directed mutagenesis of potential modification sites followed by functional assays can establish the physiological significance of specific PTMs. For studying dynamic changes in PTMs in response to environmental stimuli or developmental cues, quantitative proteomics approaches such as SILAC (stable isotope labeling by amino acids in cell culture) or TMT (tandem mass tag) labeling enable comparison across multiple conditions. These studies should be conducted in systems that closely mimic the native environment of ARALYDRAFT_471923 to ensure physiologically relevant modifications are detected.

What are common challenges in expressing and purifying ARALYDRAFT_471923 and how can they be addressed?

Membrane proteins like ARALYDRAFT_471923 present several challenges during expression and purification. Expression levels are often lower than for soluble proteins, with potential toxicity to host cells. To address this, inducible expression systems with tight regulation can help minimize toxicity before induction. The use of specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3), or Lemo21(DE3)) may improve yields. Lower induction temperatures (16-20°C) and reduced inducer concentrations often favor proper folding over high expression levels.

Solubilization from membranes requires careful detergent selection, with screening of multiple detergents recommended. Initial extraction with harsher detergents followed by exchange to milder detergents during purification may improve yields while maintaining protein stability. Inclusion of lipids or cholesterol analogs during purification can help stabilize the native structure. Protein aggregation during purification can be minimized by including glycerol in buffers, working at 4°C, and avoiding concentrating the protein to very high concentrations. For proteins with poor stability, adding specific ligands or binding partners during purification can significantly enhance stability. Finally, when traditional approaches fail, novel technologies such as styrene maleic acid lipid particles (SMALPs) or nanodiscs provide alternatives for extracting membrane proteins with their native lipid environment intact, potentially preserving structure and function better than detergent-based methods.

How can researchers troubleshoot activity assays for ARALYDRAFT_471923?

Activity assays for CASP-like proteins such as ARALYDRAFT_471923 are challenging due to their non-enzymatic functions in membrane organization. When activity appears low or inconsistent, several troubleshooting steps should be considered. First, verify protein integrity by SDS-PAGE and Western blotting, as degradation may not be immediately visible. Mass spectrometry can confirm the presence of the full-length protein and identify any truncations. The choice of detergent or lipid environment critically affects membrane protein function; systematic testing of different detergents or reconstitution into liposomes of varying lipid compositions may restore activity.

The presence of the His-tag may interfere with function; comparing the activity of tagged versus untagged protein (after protease cleavage) can identify such effects. For interaction-based assays, consider whether additional cofactors or binding partners present in the native environment might be required. Temperature and buffer conditions should be optimized, potentially screening different pH values, salt concentrations, and temperatures to identify optimal conditions. If the protein functions as part of a complex, co-expression or addition of interaction partners may be necessary for activity. Finally, consider whether the protein requires specific post-translational modifications not present in your expression system, potentially necessitating a switch to a more suitable host organism. Careful documentation of all variables across experiments facilitates identification of critical factors affecting activity.

What approaches can resolve protein aggregation and stability issues with ARALYDRAFT_471923?

Protein aggregation is a common challenge with membrane proteins like ARALYDRAFT_471923. To address this issue, researchers can implement several strategies throughout the experimental workflow. During expression, lowering temperature and inducer concentration often reduces aggregation by slowing protein production and allowing more time for proper folding and membrane insertion. The addition of chemical chaperones such as glycerol, trehalose, or DMSO to growth media can also improve folding.

For purified protein, buffer optimization is crucial. Screening different pH values, salt types and concentrations, and additives (e.g., amino acids like arginine or glutamate) can identify conditions that enhance stability. The addition of specific lipids that mimic the native membrane environment can significantly improve stability of membrane proteins. Dynamic light scattering (DLS) and size exclusion chromatography with multi-angle light scattering (SEC-MALS) are valuable techniques for monitoring aggregation state and can guide optimization efforts.

If aggregation persists, more radical approaches include protein engineering to remove aggregation-prone regions or introduce stabilizing mutations identified through computational analysis or directed evolution. Fusion to highly soluble partners (e.g., MBP, SUMO) sometimes improves behavior. For analytical purposes, mild cross-linking followed by density gradient ultracentrifugation can stabilize native oligomeric states. Finally, alternative solubilization methods such as amphipols, nanodiscs, or SMALPs that maintain a more native-like environment may resolve persistent aggregation issues by better mimicking the protein's natural membrane context.

What are the most promising new technologies for studying CASP-like proteins such as ARALYDRAFT_471923?

Emerging technologies are opening new avenues for studying challenging membrane proteins like ARALYDRAFT_471923. Cryo-electron tomography (cryo-ET) enables visualization of proteins in their native cellular context at molecular resolution, potentially revealing the organization of CASP-like proteins in plant cell membranes. This technique can be combined with correlative light and electron microscopy (CLEM) to precisely locate fluorescently labeled ARALYDRAFT_471923 within cellular ultrastructure. Proximity labeling methods such as TurboID or APEX2 are revolutionizing the study of protein-protein interactions for membrane proteins, allowing identification of the complete interactome in living cells.

Recent advances in single-particle cryo-EM, particularly the development of graphene oxide supports and Volta phase plates, have improved resolution for smaller membrane proteins. This may soon enable high-resolution structural studies of ARALYDRAFT_471923 and its complexes. For functional studies, development of optical control techniques using light-sensitive domains (optogenetics) allows precise temporal control of protein activity or localization. Cellular agriculture approaches for growing plant tissues in laboratory settings could facilitate studies of CASP-like proteins in more controlled yet physiologically relevant contexts. Finally, advances in computational methods, particularly AlphaFold2 and RoseTTAFold, are dramatically improving protein structure prediction, potentially providing structural models of ARALYDRAFT_471923 that can guide experimental design even in the absence of experimental structures.

How might systems biology approaches advance our understanding of ARALYDRAFT_471923 function?

Systems biology approaches offer powerful frameworks for understanding ARALYDRAFT_471923 in its broader biological context. Multi-omics integration combining transcriptomics, proteomics, metabolomics, and phenomics data from plants with altered ARALYDRAFT_471923 expression can reveal affected pathways and processes. Network analysis of these data can identify functional modules and potential compensatory mechanisms that activate when ARALYDRAFT_471923 function is disrupted. Such analyses may reveal unexpected connections to cellular processes beyond the known roles of CASP proteins in barrier formation.

Quantitative models of membrane domain formation incorporating CASP-like proteins could explain how these proteins contribute to the self-organization of specialized membrane regions. These models can generate testable predictions about the effects of protein modifications or environmental changes. Genome-wide CRISPR screens in plant systems, though technically challenging, could identify genetic interactions with ARALYDRAFT_471923, revealing synthetic lethal or suppressor relationships that provide insights into function. High-content imaging combined with machine learning analysis enables quantification of subtle phenotypic changes in response to ARALYDRAFT_471923 perturbation, potentially uncovering functions not evident in traditional phenotypic assays. Single-cell approaches, including single-cell transcriptomics and proteomics, can reveal cell-type-specific functions and identify rare cell populations particularly dependent on ARALYDRAFT_471923 function.

What comparative studies between species could yield insights into CASP-like protein evolution and specialization?

Comparative studies across plant species represent a powerful approach to understanding the evolution and functional specialization of CASP-like proteins. Phylogenetic analysis of CASP-like proteins from diverse plants, from mosses to flowering plants, can trace the evolutionary history of this protein family and identify conserved features that likely perform core functions. Such analyses have revealed that CASP-like proteins in Arabidopsis lyrata (including ARALYDRAFT_471923) have counterparts in Arabidopsis thaliana (such as At3g06390) and more distant relatives in other species like Glycine max (soybean) .

Complementation studies, where ARALYDRAFT_471923 is expressed in mutants of other species lacking their native CASP-like proteins, can determine the degree of functional conservation. Differences in rescue efficiency may highlight species-specific adaptations. Comparative expression analysis across species can reveal conservation or divergence in tissue-specific expression patterns, providing clues to specialized functions. Structural comparisons, either experimental or computational, can identify conserved domains versus variable regions that may confer species-specific functions.

Synteny analysis examining the genomic context of CASP-like genes across species can reveal conservation of gene clusters that might function together. This approach may identify co-evolved genes that interact with CASP-like proteins. Finally, comparative analysis of post-translational modifications can highlight species-specific regulatory mechanisms. These multi-faceted comparative approaches can reveal how CASP-like proteins have evolved and specialized in different plant lineages, providing insights into both fundamental biological principles and potential biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.