Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_478855 (ARALYDRAFT_478855)

Shipped with Ice Packs
In Stock

Description

Functional Insights

ARALYDRAFT_478855 is part of the CASPL family, which diverges from ancestral MARVEL proteins involved in membrane scaffolding . Functional studies of homologs provide insights:

  • Role in Stress Response: Arabidopsis CASPL4C1 (At3g55390), an ortholog, negatively regulates cold tolerance. Knock-out mutants exhibit enhanced cold resistance and altered growth dynamics .

  • Membrane Localization: CASPLs localize to plasma membrane domains, forming stable scaffolds critical for Casparian strip formation in roots .

  • Evolutionary Conservation: CASPLs are present in land plants and green algae, suggesting ancient roles in vascular development .

Research Applications

ARALYDRAFT_478855 is utilized in:

  • Biochemical Studies: Investigating transmembrane scaffolding mechanisms and protein-protein interactions .

  • Plant Stress Physiology: Analysing CASPL roles in abiotic stress responses (e.g., cold tolerance) .

  • Comparative Genomics: Studying evolutionary divergence of CASPL/MARVEL proteins across plant lineages .

Comparative Analysis

A comparison of recombinant CASPL proteins highlights variations in expression systems and applications:

ProteinHostLengthKey FeaturesApplication
ARALYDRAFT_478855 E. coli1–178 aaHis-tag, lyophilized, >90% purityMembrane protein studies
ARALYDRAFT_492822 E. coli1–197 aaHis-tag, 6% trehalose bufferStructural biology
AtCASPL4C1 (At3g55390) ArabidopsisFull-lengthCold-inducible, knock-out mutants availableStress response research

Limitations and Future Directions

While ARALYDRAFT_478855’s biochemical properties are well-characterized, its exact biological pathways remain understudied. Future research should focus on:

  • Elucidating its role in Casparian strip formation versus stress signaling.

  • Identifying interaction partners using co-IP or yeast two-hybrid assays .

  • Comparative studies with other CASPLs to map functional divergence .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request when possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ARALYDRAFT_478855; CASP-like protein 2A2; AlCASPL2A2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)
Target Names
ARALYDRAFT_478855
Target Protein Sequence
MDKTDQTAIDGSALELNRTEKTVEAVLRVASMALSITGLVIMIKNSISNDFGSLSYSNLG AFMYLVGANGVCAAYSLLSALAILALPCPISKVQVRTLFLLDQVVTYVVLAAGAVSAETV YLAYYGNIPITWSSACDSYGIFCHKALISVVFTFVVSLLYMLLSLISSYRLFSRFEAP
Uniprot No.

Target Background

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ARALYDRAFT_478855 and how is it classified within the plant protein family?

ARALYDRAFT_478855 is a CASP-like protein from Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress), consisting of 178 amino acids. It belongs to the CASP-like (CASPL) protein family, which is part of the broader MARVEL (MAL and related proteins for vesicle transport and membrane attachment) protein family. The CASP-like protein family is widely distributed across plant species, with ARALYDRAFT_478855 specifically categorized as a CASP-like protein 2A2 (AlCASPL2A2). These proteins are characterized by four transmembrane domains with cytoplasmic N and C termini, a variable N terminus length, short C terminus, and short intracellular loop . The CASPL family has evolutionary connections to the MARVEL protein family, which has been primarily studied in postnatal animals, suggesting a conserved functional module across diverse eukaryotes .

How should recombinant ARALYDRAFT_478855 protein be stored and reconstituted for experimental use?

The recombinant ARALYDRAFT_478855 protein is typically supplied as a lyophilized powder and requires proper handling for optimal experimental results. For storage, the protein should be kept at -20°C to -80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles, which can compromise protein integrity and activity . Working aliquots can be stored at 4°C for up to one week, but long-term storage should be at -20°C or below .

For reconstitution, the vial should first be briefly centrifuged to bring the contents to the bottom. The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage of the reconstituted protein, adding glycerol to a final concentration of 5-50% is recommended, with 50% being the standard concentration . Following reconstitution, the protein solution should be aliquoted before freezing to minimize freeze-thaw cycles. The reconstituted protein is stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain protein stability .

How do mutations in conserved residues affect CASP-like protein localization and function?

Mutational studies on CASP proteins have provided insights that may apply to ARALYDRAFT_478855 and other CASP-like proteins. The localization and function of these proteins are significantly influenced by specific conserved residues, particularly in the transmembrane domains and extracellular loops. In AtCASP1, mutations in the second extracellular loop (EL2) at residues that are conserved across most CASPLs affect protein localization to varying degrees . For instance, mutations C168S, F174V, and C175S caused the protein to persist longer at the lateral plasma membrane before localizing to the Casparian strip membrane domain (CSD) . More dramatically, the G158S mutation severely delayed CSD localization and resulted in extremely low signal levels at the CSD, while the W164G mutation showed the strongest effect, being initially excluded from the CSD and later becoming almost undetectable .

These findings suggest that for ARALYDRAFT_478855 and other CASP-like proteins, the conserved residues in transmembrane domains and extracellular loops are critical for proper localization and the formation of stable membrane domains. This knowledge is particularly valuable for researchers designing mutational studies on ARALYDRAFT_478855 to investigate its functional properties. When planning such experiments, researchers should focus on these conserved residues while recognizing that mutations in different regions may have distinct effects on protein behavior ranging from subtle temporal changes in localization to complete functional disruption .

What is the evolutionary relationship between ARALYDRAFT_478855 and other CASP/CASPL proteins across plant species?

ARALYDRAFT_478855 belongs to a large family of CASP-like proteins that have been identified across all major divisions of land plants as well as in green algae. Phylogenetic analysis has revealed that CASP and CASPL proteins share evolutionary origins with the MARVEL protein family found in animals . The conservation pattern suggests that these proteins originated early in plant evolution and have diversified to fulfill specialized functions in different plant lineages.

The most conserved features across the CASPL family are found in the transmembrane domains, particularly TM1 and TM3, where an Arginine in TM1 and an Aspartic acid in TM3 are present in the vast majority of CASPLs . This conservation pattern indicates these amino acids are functionally significant. In contrast to this broad conservation, the CASP subfamily that is specifically involved in Casparian strip formation possesses a distinctive nine-amino acid signature (ESLPFFTQF) in the first extracellular loop (EL1) . This signature is absent in more basal plant species like Physcomitrella patens and Selaginella moellendorffii, correlating with the appearance of Casparian strips in plant evolution .

The presence of ARALYDRAFT_478855 in Arabidopsis lyrata, compared to its homologs in Arabidopsis thaliana and other species, provides an opportunity to study how these proteins have adapted to different ecological niches while maintaining core structural features. This evolutionary perspective is essential for understanding the functional diversification of CASP-like proteins across plant species and their roles in specialized cellular processes.

What are the optimal conditions for expressing and purifying recombinant ARALYDRAFT_478855?

The optimal expression and purification of recombinant ARALYDRAFT_478855 requires careful consideration of several parameters. Based on studies with similar CASP-like proteins, such as AtCASPL1D2, the following conditions are recommended:

ParameterOptimal ConditionsNotes
Expression SystemE. coli BL21Standard system for recombinant protein expression
VectorpET-32a or similarEnables His-tag fusion for purification
IPTG ConcentrationVariable (to be optimized)Typically 0.1-1.0 mM
Induction TemperatureVariable (to be optimized)Lower temperatures (16-25°C) may improve folding
Induction TimeVariable (to be optimized)Typically 4-16 hours
Purification MethodNi-NTA affinity chromatographyLeverages the His-tag for selective binding
Buffer SystemTris/PBS-based, pH 8.0Contains 6% Trehalose for stability

When expressing CASP-like proteins, researchers should be aware that as membrane proteins, they may form inclusion bodies or exhibit toxicity to the host cells when overexpressed. Starting with small-scale expression trials to optimize IPTG concentration, temperature, and induction time is recommended. For AtCASPL1D2, the gene (600 bp) was successfully cloned into pET-32a and expressed as a His fusion protein in E. coli BL21 under optimized conditions . Similar approaches should be applicable to ARALYDRAFT_478855, with the specific parameters requiring experimental optimization for maximum yield and purity.

What techniques are most effective for studying the membrane localization and dynamics of ARALYDRAFT_478855?

Studying the membrane localization and dynamics of ARALYDRAFT_478855 requires specialized techniques suitable for membrane proteins. Based on research with other CASP-like proteins, the following approaches are recommended:

  • Fluorescent Protein Tagging: Generating fusion proteins with GFP, mCherry, or other fluorescent proteins allows for visualization of protein localization in living cells. For instance, AtCASP1-mCherry fusions have been used to track the formation of the Casparian strip membrane domain .

  • Time-Lapse Confocal Microscopy: This technique is essential for studying the dynamics of protein localization. Previous studies have revealed that CASP proteins initially localize to the whole plasma membrane before becoming restricted to specialized domains .

  • Photobleaching Techniques (FRAP/FLIP): Fluorescence Recovery After Photobleaching (FRAP) and Fluorescence Loss In Photobleaching (FLIP) can assess protein mobility within membranes, providing insights into the stability of protein domains and interactions.

  • Heterologous Expression Systems: Expressing ARALYDRAFT_478855 in systems where it is not natively found (e.g., Arabidopsis thaliana endodermis) can reveal its intrinsic properties for domain formation and protein-protein interactions .

  • Co-localization Studies: Dual-labeling experiments with other membrane markers or potential interacting partners can identify spatial relationships and functional associations.

For these studies, researchers should consider generating stable transgenic lines expressing fluorescently tagged ARALYDRAFT_478855 under either native or constitutive promoters. Alternatively, transient expression systems may be used for rapid screening of localization patterns or mutant variants. When designing fusion proteins, careful consideration should be given to the tag position (N- or C-terminal) as this may affect protein folding, localization, or function .

How can researchers distinguish between functional and non-functional ARALYDRAFT_478855 in experimental settings?

Distinguishing between functional and non-functional forms of ARALYDRAFT_478855 requires multiple complementary approaches to assess both structural integrity and biological activity. Researchers should implement the following strategies:

  • Structural Assessment:

    • SDS-PAGE and Western blotting can confirm protein size and expression levels

    • Circular dichroism (CD) spectroscopy can verify proper secondary structure formation, particularly important for transmembrane proteins

    • Limited proteolysis assays may reveal whether the protein is properly folded based on its susceptibility to enzymatic digestion

  • Localization Analysis:

    • Functional CASP-like proteins typically display specific subcellular localization patterns

    • In heterologous systems, ARALYDRAFT_478855 should be able to integrate into membrane domains similar to other CASPLs when expressed in appropriate tissues

    • Mutational analysis targeting conserved residues (e.g., Arg in TM1 and Asp in TM3) can be used as controls for non-functional variants

  • Complementation Assays:

    • Testing whether ARALYDRAFT_478855 can rescue phenotypes in mutants lacking related CASP or CASPL proteins

    • Assessing whether it can form appropriate membrane domains in heterologous expression systems

  • Functional Interaction Studies:

    • Co-immunoprecipitation followed by mass spectrometry to identify interaction partners

    • Evaluation of whether the protein can recruit expected partners like peroxidases involved in cell wall modification

The gold standard for functionality would be complementation assays in appropriate genetic backgrounds, coupled with subcellular localization studies showing proper membrane domain formation. Researchers should be cautious when interpreting results from in vitro studies alone, as membrane proteins often require the proper lipid environment and interacting partners to achieve their native conformation and function .

What comparative analyses between ARALYDRAFT_478855 and other CASP-like proteins yield the most insight?

Comparative analyses between ARALYDRAFT_478855 and other CASP-like proteins can provide valuable insights into its function, evolution, and specialization. The following comparative approaches are particularly informative:

  • Sequence-Structure-Function Relationships:

Protein FeatureCASP ProteinsCASPL ProteinsARALYDRAFT_478855Functional Implication
Transmembrane Domains444Core structural scaffold
Conserved Arg in TM1PresentPresent in mostPresentMembrane domain formation
Conserved Asp in TM3PresentPresent in mostPresentMembrane domain formation
9-aa signature in EL1PresentAbsent in mostRequires verificationEndodermis-specific function
Interaction with peroxidasesConfirmedVariableRequires investigationCell wall modification capability
  • Evolutionary Conservation Analysis:

    • Comparing ARALYDRAFT_478855 to homologs across plant species can reveal conserved functional motifs

    • Cross-kingdom comparison with MARVEL proteins in animals may identify fundamental functional modules conserved through evolution

    • Analysis of selective pressure on different protein domains can highlight regions critical for function

  • Expression Pattern Comparison:

    • Comparing tissue-specific expression patterns of ARALYDRAFT_478855 with other CASPLs can suggest functional specialization

    • Correlation of expression patterns with specific developmental or stress responses may indicate specialized roles

  • Mutational Impact Assessment:

    • Comparing the effects of equivalent mutations across different CASP/CASPL proteins can reveal functional conservation or divergence

    • Particular attention should be paid to mutations affecting conserved residues in transmembrane domains and extracellular loops

These comparative analyses should be conducted systematically, with careful documentation of similarities and differences. Researchers should be mindful that functional conservation might not always correspond to sequence conservation, and that proteins may have evolved different functions despite structural similarities. Integrating these comparative analyses with experimental validation will provide the most comprehensive understanding of ARALYDRAFT_478855's biological role .

What are the most promising approaches for elucidating the physiological role of ARALYDRAFT_478855 in Arabidopsis lyrata?

Several promising approaches could help elucidate the physiological role of ARALYDRAFT_478855 in Arabidopsis lyrata:

  • CRISPR-Cas9 Gene Editing: Generating knockout or knock-in mutants of ARALYDRAFT_478855 in Arabidopsis lyrata would allow direct assessment of its physiological functions . This approach could reveal phenotypes related to cell wall formation, membrane domain organization, or stress responses.

  • Tissue-Specific Expression Analysis: Detailed characterization of when and where ARALYDRAFT_478855 is expressed using techniques like RNA-seq, in situ hybridization, or reporter gene constructs would provide clues about its biological role. Similar to other CASP-like proteins, it may have tissue-specific functions that relate to specialized membrane structures .

  • Interactome Mapping: Identifying proteins that interact with ARALYDRAFT_478855 through techniques like yeast two-hybrid, co-immunoprecipitation coupled with mass spectrometry, or proximity labeling approaches would help place it within cellular pathways. Of particular interest would be potential interactions with peroxidases or other enzymes involved in cell wall modification, similar to the interactions observed with other CASP proteins .

  • Comparative Physiology Studies: Examining how ARALYDRAFT_478855 function differs between Arabidopsis lyrata and other Arabidopsis species could provide insights into its role in adaptation to different ecological niches. This is particularly relevant given that CASP-like proteins may be involved in stress responses and environmental adaptation .

  • Single-Cell Approaches: Applying single-cell transcriptomics or proteomics to identify co-expression networks and potential functional associations of ARALYDRAFT_478855 at cellular resolution could reveal cell-specific roles that might be masked in whole-tissue analyses .

These approaches should be pursued in parallel and integrated to build a comprehensive understanding of ARALYDRAFT_478855's physiological role. Researchers should also consider the potential redundancy among CASP-like family members, which might necessitate multiple gene knockouts to observe clear phenotypes .

How might research on ARALYDRAFT_478855 contribute to advances in plant biotechnology and agriculture?

Research on ARALYDRAFT_478855 and related CASP-like proteins has several potential applications in plant biotechnology and agriculture:

  • Engineering Improved Water and Nutrient Use Efficiency: CASP proteins are involved in forming Casparian strips, which regulate water and nutrient uptake in roots. Understanding and potentially modifying CASP-like proteins like ARALYDRAFT_478855 could lead to crops with enhanced water use efficiency or improved nutrient uptake characteristics .

  • Stress Resistance Enhancement: If ARALYDRAFT_478855 is involved in membrane domain organization that responds to environmental stresses, manipulating its expression or function could potentially enhance plant resistance to drought, salinity, or other abiotic stresses .

  • Cell Wall Engineering: Given the role of CASP proteins in directing cell wall modifications, knowledge about ARALYDRAFT_478855 could contribute to strategies for altering cell wall properties. This has potential applications in biofuel production, where modified cell walls could enhance the efficiency of biomass conversion .

  • Translational Research to Crop Species: Insights from ARALYDRAFT_478855 in Arabidopsis lyrata can inform similar research in crop plants. The mechanistic understanding gained could be applied to identify and characterize homologous proteins in species like rice, wheat, or maize, potentially leading to improved crop varieties .

  • Development of Novel Biomarkers: If ARALYDRAFT_478855 expression or localization changes in response to specific environmental conditions, it could potentially serve as a biomarker for early detection of plant stress, allowing for timely intervention in agricultural settings.

These potential applications highlight the importance of fundamental research on proteins like ARALYDRAFT_478855, which can ultimately translate into practical agricultural innovations. Researchers should consider these broader implications when designing experiments and interpreting results, while maintaining focus on rigorous scientific investigation of the protein's basic biological functions .

What are the key considerations for researchers beginning work with ARALYDRAFT_478855?

Researchers beginning work with ARALYDRAFT_478855 should consider several key factors to ensure successful experimental outcomes. First, understanding the structural characteristics of this four-transmembrane domain protein is essential, particularly its conserved residues in TM1 (Arg) and TM3 (Asp) that are likely critical for its function . Second, proper handling of the recombinant protein is crucial, including appropriate storage conditions (-20°C to -80°C), avoiding repeated freeze-thaw cycles, and reconstitution in recommended buffers (Tris/PBS-based buffer with 6% Trehalose at pH 8.0) .

Methodologically, researchers should carefully design expression systems for this membrane protein, optimizing conditions like IPTG concentration, induction temperature, and duration to maximize yield while preserving protein functionality . For localization studies, fluorescent protein fusions should be designed with consideration of how tag position might affect protein folding and function . When conducting comparative analyses, researchers should leverage the extensive knowledge of other CASP and CASPL proteins while recognizing that ARALYDRAFT_478855 may have unique properties specific to Arabidopsis lyrata.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.