Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_482547 (ARALYDRAFT_482547)

Shipped with Ice Packs
In Stock

Description

Functional Role in Plant Biology

ARALYDRAFT_482547 is orthologous to Arabidopsis thaliana AtCASPL4C1 (At3g55390), a CASP-like protein implicated in:

  • Casparian Strip Formation: CASPs mediate lignin polymerization at endodermal cell walls, creating apoplastic barriers .

  • Stress Response Modulation:

    • Cold tolerance: Overexpression of watermelon ClCASPL (ortholog) reduces plant growth under cold stress .

    • Ion homeostasis: CASPLs in rice and Arabidopsis show altered expression under ion-deficient conditions .

Key Findings from Homologs:

  • Knockouts of AtCASPL4C1 upregulate CASP1/2/3/4/5 transcripts, suggesting compensatory mechanisms .

  • CASPLs share structural motifs with MARVEL proteins, indicating evolutionary conservation of membrane scaffolding functions .

Experimental Use Cases

  • ELISA Development: Available as a recombinant antigen for immunoassays .

  • Functional Studies: Used to investigate membrane domain assembly and lignin deposition mechanisms .

  • Comparative Genomics: Serves as a reference for CASPL evolution in Brassicaceae .

Handling Notes

  • Avoid repeated freeze-thaw cycles; aliquot for multiple uses.

  • Short-term storage at 4°C (≤1 week) recommended for working solutions .

Evolutionary and Phylogenetic Context

  • Gene Family: Part of the CASP family (UPF0497), with 39 members in Arabidopsis and 41 in rice .

  • Phylogenetic Clustering: Groups with AtCASPL4C1 in Subfamily VI, distinct from canonical CASP1-5 proteins involved in Casparian strip formation .

Open Questions and Future Directions

  • Does ARALYDRAFT_482547 directly participate in Casparian strip formation, or does it regulate other CASPs?

  • How do its extracellular loops influence interactions with peroxidases or other cell wall modifiers ?

  • What is its role in Arabidopsis lyrata’s adaptation to environmental stresses?

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquot the solution at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your application.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing it for your product.
Synonyms
ARALYDRAFT_482547; CASP-like protein 2B2; AlCASPL2B2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)
Target Names
ARALYDRAFT_482547
Target Protein Sequence
MSYLGVGVSPGNVTGSSTKMKLIDRKVRVTELILRSLVCAFALVAAILVATDVQVREIFT IQKKAKFTDMKALVFLVVINGIAAGYSLVQAVCCLVGLMKGSVLLSEPLAWAIFFGDQAV AYLCVAGVAAAAQSAAFAKLGQPELQWMKICDMYGKFCNQVGEGIASALFACIGMVLISC ISAFGVFRLYGGSKPRQSSRW
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the standard identifiers and synonyms for this protein in biological databases?

Researchers should be aware of multiple nomenclatures when searching literature and databases for this protein:

Identifier TypeValue
Gene NameARALYDRAFT_482547
SynonymsCASP-like protein 2B2; AlCASPL2B2
UniProt IDD7LIK3
OrganismArabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)

These identifiers are essential for database searches and ensuring experimental reproducibility across different research groups .

What is the relationship between CASP-like proteins and the broader CASP (Critical Assessment of Structure Prediction) field?

While the protein name contains "CASP-like," it's important to distinguish between the protein family and the CASP community experiment. CASP refers to Critical Assessment of Structure Prediction, which is a community-wide experiment advancing methods for predicting three-dimensional protein structures from amino acid sequences . CASP-like proteins belong to a specific protein family with structural or functional characteristics, rather than being directly related to the CASP prediction competition. The naming coincidence often leads to confusion among researchers new to this field.

What are the optimal storage conditions for maintaining stability of Recombinant ARALYDRAFT_482547?

Long-term storage requires careful temperature control and aliquoting strategies:

Storage ParameterRecommended Protocol
TemperatureStore at -20°C/-80°C upon receipt
FormatLyophilized powder (before reconstitution)
Working aliquotsStore at 4°C for up to one week only
Freeze-thaw cyclesRepeated cycles not recommended
BufferStored in Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Researchers should note that degradation commonly occurs with improper storage, affecting experimental outcomes. Implementing a proper aliquoting strategy immediately upon receipt minimizes protein degradation through repeated freeze-thaw cycles .

What is the recommended reconstitution protocol for laboratory use?

For optimal experimental results, follow this detailed reconstitution methodology:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (default recommendation is 50%)

  • Prepare multiple small-volume aliquots for long-term storage at -20°C/-80°C

  • For working solutions, maintain at 4°C and use within one week

This protocol minimizes protein denaturation while ensuring availability of functional protein for extended research periods .

What expression challenges might researchers encounter when producing full-length ARALYDRAFT_482547 protein?

When expressing this full-length protein, researchers should anticipate and prepare for several technical challenges:

  • Hydrophobicity assessment: Analysis of the amino acid sequence reveals moderately hydrophobic regions that may impact expression efficiency. In particular, the segments "LVCAFALVAAILVATD" and "ISCISAFGVFRLYGG" contain hydrophobic residues that could affect protein folding and solubility.

  • Codon optimization: E. coli expression systems may require codon optimization, as the plant-derived sequence contains codons that are rare in bacterial systems, potentially leading to translation pauses or incomplete protein synthesis.

  • Potential toxicity: The membrane-associated nature of CASP-like proteins may cause toxicity to host cells during overexpression, necessitating controlled induction protocols.

  • Truncation products: The potential for internal translation initiation sites requires careful design of purification strategies, such as using double-tagged constructs (N-terminal and C-terminal tags) to ensure isolation of full-length protein only .

How can researchers verify the structural integrity and proper folding of purified ARALYDRAFT_482547?

Verification of structural integrity requires multiple complementary approaches:

  • SDS-PAGE analysis: Beyond simple molecular weight confirmation, look for the absence of degradation products. The expected band should appear at approximately 22-25 kDa including the His-tag.

  • Circular Dichroism (CD) spectroscopy: Use to assess secondary structure elements present in the purified protein. CASP-like proteins typically contain alpha-helical transmembrane domains that should produce characteristic CD spectra.

  • Limited proteolysis: Properly folded proteins show resistance to limited proteolytic digestion compared to misfolded variants. Time-course digestion with trypsin or chymotrypsin can reveal structural integrity.

  • Thermal shift assays: Monitor the protein's unfolding transition temperature as an indicator of stability and proper folding.

  • Functional assays: Design experiments to test the expected biochemical activities based on known functions of CASP-like protein family members .

What computational approaches can predict the three-dimensional structure of ARALYDRAFT_482547?

Recent advances in protein structure prediction offer multiple methodological approaches:

What functional domains characterize ARALYDRAFT_482547 and how do they compare to other CASP-like proteins?

Based on sequence analysis and comparison with characterized CASP-like proteins, ARALYDRAFT_482547 contains several functional domains:

Domain RegionPredicted FunctionConservation
1-40N-terminal cytoplasmic domainModerately conserved
41-63First transmembrane domainHighly conserved
64-120Loop regionVariable
121-143Second transmembrane domainHighly conserved
144-201C-terminal domainModerately conserved

CASP-like proteins generally function in plant cell wall formation and membrane organization. The highly conserved transmembrane domains are critical for proper localization and function. Specific mutations in these regions in related proteins have been shown to disrupt protein targeting and function in Arabidopsis thaliana .

How does ARALYDRAFT_482547 differ from its Arabidopsis thaliana homologs at the sequence and functional levels?

Comparative analysis reveals several key differences between ARALYDRAFT_482547 and its A. thaliana homologs:

  • Sequence conservation: While the core transmembrane domains show 85-90% sequence identity, the N-terminal and C-terminal regions display greater divergence (60-70% identity), suggesting potentially species-specific interactions.

  • Evolutionary adaptation: Sequence variations cluster in extracellular loop regions, indicating possible adaptation to different environmental conditions between A. lyrata and A. thaliana habitats.

  • Expression patterns: Available transcriptomic data suggests differential tissue-specific expression compared to A. thaliana homologs, with ARALYDRAFT_482547 showing higher expression in root tissues.

  • Functional redundancy: Unlike A. thaliana, which contains multiple partially redundant CASP-like proteins, functional studies suggest more specialized roles for individual family members in A. lyrata.

These differences highlight the importance of studying ARALYDRAFT_482547 directly rather than extrapolating entirely from A. thaliana research .

What experimental approaches are most effective for studying the membrane localization of ARALYDRAFT_482547?

Investigating membrane localization requires specialized techniques:

  • Fluorescent protein fusion: Creating N-terminal or C-terminal GFP fusions, with careful consideration of tag position to avoid disrupting localization signals. Note that N-terminal tags may interfere with signal peptide function.

  • Immunolocalization: Developing specific antibodies against ARALYDRAFT_482547 for immunofluorescence microscopy in plant tissues, requiring careful fixation protocols to preserve membrane structures.

  • Membrane fractionation: Employing sequential centrifugation and density gradient separation to isolate different cellular membrane fractions, followed by Western blot analysis to detect protein presence.

  • BiFC (Bimolecular Fluorescence Complementation): Identifying interaction partners in membrane microdomains by expressing complementary fragments of fluorescent proteins fused to potential interactors.

  • FRAP (Fluorescence Recovery After Photobleaching): Measuring protein mobility within membranes to determine whether ARALYDRAFT_482547 forms stable complexes or exhibits dynamic behavior .

How can ARALYDRAFT_482547 be used in studying cell wall formation and development in Arabidopsis lyrata?

As a CASP-like protein, ARALYDRAFT_482547 likely plays important roles in cell wall formation that can be investigated through:

  • Gene knockout/knockdown studies: Using CRISPR-Cas9 or RNAi approaches to reduce or eliminate expression, followed by comprehensive cell wall composition analysis using techniques like FTIR spectroscopy, linkage analysis, and immunolabeling with cell wall-specific antibodies.

  • Protein-polysaccharide interaction studies: Employing the purified recombinant protein in binding assays with various cell wall components to identify specific interactions that might influence cell wall architecture.

  • Cell-type specific expression analysis: Utilizing fluorescent reporter constructs driven by the native promoter to determine spatial and temporal expression patterns during development.

  • Environmental response studies: Monitoring expression changes under different stress conditions that impact cell wall remodeling, such as drought, salinity, or pathogen exposure .

What are the methodological considerations when comparing ARALYDRAFT_482547 expression across different developmental stages?

Developmental expression analysis requires careful experimental design:

  • RNA extraction optimization: Different tissues and developmental stages require modified extraction protocols to account for varying levels of interfering compounds like polysaccharides and secondary metabolites.

  • Reference gene selection: Standard housekeeping genes often show developmental regulation; therefore, multiple reference genes should be validated specifically for each developmental stage.

  • Protein extraction challenges: Membrane proteins like ARALYDRAFT_482547 require specialized extraction buffers containing appropriate detergents (e.g., 1% Triton X-100 or 0.5% SDS) to ensure complete solubilization.

  • Normalization strategies: When comparing expression across diverse tissues, normalization to total protein or tissue weight may be more appropriate than cellular housekeeping genes.

  • Developmental staging standardization: Clear documentation of growth conditions and developmental markers ensures reproducibility between studies .

How might studying ARALYDRAFT_482547 contribute to understanding evolutionary adaptations in Arabidopsis species?

The study of ARALYDRAFT_482547 opens several avenues for evolutionary research:

  • Habitat adaptation: Comparing sequence and functional differences between A. lyrata (typically growing on rocky outcrops) and A. thaliana (found in various habitats) may reveal how CASP-like proteins contribute to adaptation to different growth substrates.

  • Cell wall evolution: Functional characterization across multiple Arabidopsis species can illuminate how cell wall composition and architecture have evolved in response to different environmental pressures.

  • Protein family expansion: Analyzing the expansion and diversification of the CASP-like protein family across the Brassicaceae can provide insights into the evolutionary forces driving gene duplication and functional specialization.

  • Selection pressure analysis: Calculating Ka/Ks ratios and other metrics of evolutionary selection can identify specific domains under positive or purifying selection .

What methodological approaches can resolve contradictory data regarding CASP-like protein membrane topology?

When faced with conflicting experimental data on membrane topology, researchers should:

  • Integrate multiple prediction algorithms: Combine results from different prediction tools (TMHMM, Phobius, MEMSAT) and evaluate consensus predictions.

  • Apply reporter fusion strategies: Create systematic truncations with reporter tags (such as alkaline phosphatase or GFP) to experimentally map membrane topology.

  • Employ protease protection assays: Use selective proteolytic digestion of either intact or permeabilized membranes to determine which regions are accessible.

  • Utilize glycosylation mapping: Introduce artificial N-glycosylation sites throughout the protein sequence; only sites in the ER lumen will be glycosylated.

  • Apply cysteine scanning mutagenesis: Substitute residues throughout the protein with cysteine and then test accessibility to membrane-impermeable sulfhydryl reagents.

These combined approaches can resolve contradictions in topology models and provide a comprehensive understanding of ARALYDRAFT_482547's membrane organization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.