Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_492333 (ARALYDRAFT_492333)

Shipped with Ice Packs
In Stock

Description

Protein Information and Properties

The following table summarizes the key properties of Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_492333:

PropertyDescription
SpeciesArabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)
Gene NameARALYDRAFT_492333
SynonymsCASP-like protein 1F1; AlCASPL1F1
UniProt IDD7MGK0
Protein LengthFull Length (1-170 amino acids)
Expression SystemE. coli
TagHis-tag (N-terminal)
Physical FormLyophilized powder
Purity>90% (determined by SDS-PAGE)

The protein's structure is characteristic of membrane proteins, with multiple transmembrane domains that anchor it within cellular membranes . This structural arrangement is fundamental to its function in membrane organization and potential involvement in cell wall modifications, similar to other CASPL proteins .

Evolutionary Context and Relationship to CASPL Family

Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_492333 belongs to the broader family of CASP-like proteins, which have been identified across diverse plant species . Phylogenetic analyses have revealed that CASPLs are present in all major divisions of land plants and even in green algae, indicating their evolutionarily conserved and fundamental roles in plant biology .

Interestingly, CASPL proteins share homology with the MARVEL (MAL and Related proteins for VEsicle trafficking and membrane Link) protein family found in animals, suggesting an ancient evolutionary origin for these membrane-organizing proteins . The conservation of specific residues, particularly in the transmembrane domains, points to their functional importance across evolution.

The evolution of CASPL proteins is closely linked to the development of specialized plant structures. While the specific function of ARALYDRAFT_492333 has not been fully characterized, research on related CASPL proteins provides insights into its potential roles. CASPLs have been found to show tissue-specific expression patterns in various cell types, including trichomes, abscission zone cells, peripheral root cap cells, and xylem pole pericycle cells, suggesting diverse functions in different plant tissues .

Conservation and Variation in CASPL Proteins

A notable feature of CASP proteins is the presence of a nine-amino acid signature (ESLPFFTQF) in their first extracellular loop (EL1), which is highly conserved in spermatophytes but absent in plants lacking Casparian strips . While the search results do not specifically mention whether ARALYDRAFT_492333 contains this signature, its classification as a CASPL protein suggests potential structural similarities to other members of this family.

Conservation analysis across different plant species has revealed that while transmembrane domains are highly conserved in CASPL proteins, the extracellular loops show greater variability . Mutagenesis studies of related CASP proteins have demonstrated that while the extracellular loops contribute to proper localization, they are not strictly essential for it, suggesting a degree of functional redundancy .

Functional Implications in Plant Biology

As a member of the CASPL family, ARALYDRAFT_492333 protein likely shares functional characteristics with other CASPLs, particularly in membrane domain organization . CASP proteins are known to mediate the deposition of Casparian strips in the endodermis by recruiting the lignin polymerization machinery, and they show high stability in their membrane domains, presenting all the hallmarks of a membrane scaffold .

When ectopically expressed in the endodermis, most CASPL proteins are able to integrate the CASP membrane domain, suggesting that CASPLs share with CASPs the propensity to form transmembrane scaffolds . This ability to organize membrane domains is likely a core function of ARALYDRAFT_492333 as well.

The potential functions of ARALYDRAFT_492333 can be inferred from studies of other CASPL proteins, which have demonstrated dual roles:

  1. Forming membrane scaffolds or "membrane fences" that compartmentalize the plasma membrane

  2. Directing localized modifications of the cell wall adjacent to their membrane domain

These two functions can be uncoupled, as formation of CASP domains is independent of cell wall modification processes, suggesting distinct molecular mechanisms for these activities .

Potential Role in Cell Wall Modification

CASP proteins are known to interact with secreted peroxidases, mediating the deposition of lignin and building up specialized cell wall structures like Casparian strips . While the specific cell wall modification role of ARALYDRAFT_492333 has not been directly characterized in the search results, its classification as a CASPL protein suggests potential involvement in similar processes.

This putative function in directing cell wall modifications makes ARALYDRAFT_492333 a potentially valuable target for studies focused on plant cell wall architecture, which has implications for plant development, stress responses, and biotechnological applications.

Expression and Purification of the Recombinant Protein

The recombinant expression of Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_492333 has been successfully achieved in E. coli expression systems, resulting in a His-tagged protein that can be purified to greater than 90% purity as determined by SDS-PAGE . This level of purity is essential for downstream applications, including structural studies, functional assays, and protein-protein interaction analyses.

The expression of full-length membrane proteins like ARALYDRAFT_492333 presents several challenges, including issues related to protein hydrophobicity, codon usage, and potential toxicity to host cells . Successful expression requires optimization of expression conditions and careful consideration of protein sequence and secondary structure characteristics .

Research Applications and Significance

The availability of recombinant ARALYDRAFT_492333 protein opens numerous avenues for research in plant biology and biotechnology. As a full-length protein, it provides the complete amino acid sequence necessary for comprehensive structural and functional studies .

Potential Applications in Research

The recombinant ARALYDRAFT_492333 protein can be utilized in various research applications:

  1. Structural studies: The purified protein can be used for crystallization trials and other structural biology techniques to determine its three-dimensional structure, providing insights into its function .

  2. Protein-protein interaction studies: The recombinant protein can serve as bait in pull-down assays or other interaction studies to identify binding partners, helping to elucidate its role in cellular processes .

  3. Functional assays: In vitro assays can be developed to assess the protein's potential enzymatic activities or other biochemical functions .

  4. Antibody production: The purified protein can be used to generate specific antibodies for detection and localization studies in plant tissues .

  5. Comparative studies: Comparing the properties of ARALYDRAFT_492333 with other CASPL proteins can provide insights into functional diversification within this protein family .

Relevance to Understanding Plant Membrane Biology

Research on ARALYDRAFT_492333 and related CASPL proteins contributes to our fundamental understanding of plant membrane organization and specialization. The formation of membrane domains is crucial for various cellular processes, including signaling, transport, and cell wall modification .

Understanding the molecular mechanisms by which CASPL proteins like ARALYDRAFT_492333 organize membrane domains can provide insights into plant development, adaptation to environmental stresses, and evolution of specialized structures like Casparian strips . This knowledge has potential applications in improving crop resilience and developing novel biotechnological approaches for plant modification.

Future Research Directions

Future research on Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_492333 could focus on several promising areas:

Tissue-Specific Expression and Localization

While general expression patterns have been described for CASPL proteins in Arabidopsis thaliana, specific information about the expression and localization of ARALYDRAFT_492333 in Arabidopsis lyrata tissues would be valuable . Techniques such as RNA-seq, in situ hybridization, and immunolocalization with specific antibodies could map its distribution in different plant tissues and developmental stages.

Functional Characterization through Genetic Approaches

Generation of knockout or knockdown lines in Arabidopsis lyrata could reveal phenotypic consequences of ARALYDRAFT_492333 deficiency, providing insights into its physiological roles. Complementation studies and overexpression analyses would further elucidate its functions in planta.

Interactome Analysis

Identifying the protein interaction network of ARALYDRAFT_492333 would shed light on its functional partners and molecular mechanisms. Techniques such as co-immunoprecipitation, yeast two-hybrid screening, or proximity labeling approaches could uncover novel interactions that place this protein in specific cellular pathways.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly include your request in the order notes and we will fulfill it to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is recommended to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
ARALYDRAFT_492333; CASP-like protein 1F1; AlCASPL1F1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)
Target Names
ARALYDRAFT_492333
Target Protein Sequence
MMGDNEGRRTPLLNLGVQVSMRVLIIGAAMASMWVMITNREVASVYGIAFEAKYSYSSAF RYLVYAQIAVCAATLFTLVWACLAVRRRGLVFALFFFDLLTTLTAISAFSAAFAEGYVGK YGNKQAGWLPICGYVHVYCSRVTISLAMSFASFVLLFILTVLTASSARHY
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ARALYDRAFT_492333 and what is its basic structure?

ARALYDRAFT_492333 is a CASP-like protein from Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress). It is available as a recombinant full-length protein consisting of 170 amino acids . The protein belongs to the CASP (Casparian Strip membrane domain proteins) family, which are homologues of occludins, components of tight junctions in animals . Like other members of the CASP family, ARALYDRAFT_492333 likely has four predicted transmembrane domains with cytoplasmic N and C termini, a variable N terminus length, short C terminus, and short intracellular loop . CASP proteins are part of the MARVEL protein family and display conservation in the transmembrane domains, particularly in TM1 and TM3, with an arginine residue in TM1 and an aspartic acid residue in TM3 being present in the vast majority of CASP-like proteins (CASPLs) .

What is the predicted functional role of ARALYDRAFT_492333 in Arabidopsis lyrata?

Based on homology with other CASP proteins, ARALYDRAFT_492333 is likely involved in the formation of Casparian strips, which are aligned bands of lignin-impregnated cell walls that create extracellular diffusion barriers in plant roots . The protein is predicted to participate in generating specialized plasma membrane domains and modifying cell walls . CASP-marked membranes display cell wall (matrix) adhesion and membrane protein exclusion properties . These membrane domains are crucial for establishing the polar localization of proteins needed for Casparian strip formation and function as a boundary between different plasma membrane domains . Studies on CASP proteins have shown that they help displace initial secretory foci by excluding vesicle tethering factors, thereby ensuring rapid fusion of microdomains into a membrane-cell wall band that seals the extracellular space .

How does ARALYDRAFT_492333 compare structurally to other CASP-like proteins?

ARALYDRAFT_492333 is part of the broader CASPL (CASP-like) protein family found across plant species. The protein likely shares the structural features common to this family:

Structural FeatureARALYDRAFT_492333Other CASPLs
Transmembrane domains4 predicted4 conserved
N-terminusCytoplasmic, variable lengthCytoplasmic, variable length
C-terminusCytoplasmic, shortCytoplasmic, short
Key conserved residuesArg in TM1, Asp in TM3 (predicted)Arg in TM1, Asp in TM3 (highly conserved)
Extracellular loop 1 (EL1)May contain endodermis-specific signatureSome contain 9-amino acid signature (ESLPFFTQF)

The degree of conservation suggests functional importance of these structural elements . While the specific sequence of ARALYDRAFT_492333 may differ from other CASPLs, the conservation of key residues and domain organization indicates a similar role in membrane domain organization and cell wall modification.

What experimental approaches should be used to study the localization and function of ARALYDRAFT_492333 in planta?

To study ARALYDRAFT_492333 localization and function in planta, researchers should consider the following methodological approaches:

  • Fluorescent protein fusion constructs: Create translational fusions with GFP or other fluorescent proteins to visualize the subcellular localization of ARALYDRAFT_492333. Based on studies with other CASP proteins, expression should be driven by the native promoter to maintain authentic expression patterns . Previous research demonstrated that a 2-kb genomic fragment upstream of the translational start codon of a Lotus japonicus CASP gene was sufficient to drive expression in the endodermis .

  • Proximity labeling techniques: Techniques such as BioID or TurboID can identify potential protein interactors. This approach has been used successfully with other CASP proteins to identify Rab-GTPases and exocyst components as interaction partners .

  • CRISPR/Cas9 gene editing: Generate knockout or knockdown lines to study loss-of-function phenotypes. For CASP proteins, full knockout analysis revealed that they are not needed for localized lignification but are essential for proper microdomain organization .

  • Transmission electron microscopy: To analyze ultrastructural features of cell walls and membrane domains in wild-type versus mutant plants. Previous studies showed disorganized microdomains with excessive cell wall growth and lack of exclusion zones in CASP mutants .

  • Barrier function assays: Test the integrity of the apoplastic barrier using fluorescent tracers or ion uptake experiments to assess the functional impact of ARALYDRAFT_492333 mutations.

What is known about the relationship between ARALYDRAFT_492333 and vesicle trafficking machinery?

While specific information about ARALYDRAFT_492333's interaction with vesicle trafficking machinery is not explicitly detailed in the search results, we can infer likely relationships based on studies of other CASP family proteins:

CASP proteins have been shown to interact with components of the exocyst complex and Rab-GTPases, which are key regulators of vesicle trafficking . Proximity-labeling studies identified a Rab-GTPase subfamily, known to be exocyst activators, as potential CASP-interactors . The current model suggests that CASP microdomains function by displacing initial secretory foci through the exclusion of vesicle tethering factors . This exclusion mechanism ensures the rapid fusion of microdomains into a continuous membrane-cell wall band .

For ARALYDRAFT_492333 specifically, researchers should investigate:

  • Whether it colocalizes with exocyst subunits using fluorescent protein fusions

  • If Rab-GTPases are excluded from ARALYDRAFT_492333-enriched domains

  • How manipulation of exocyst components affects ARALYDRAFT_492333 localization and function

  • The temporal relationship between ARALYDRAFT_492333 domain formation and changes in vesicle trafficking patterns

These investigations would help determine if ARALYDRAFT_492333 functions similarly to other CASP proteins in regulating vesicle trafficking at specialized membrane domains.

How do mutations in ARALYDRAFT_492333 affect membrane domain formation and Casparian strip development?

Based on studies of related CASP proteins, mutations in ARALYDRAFT_492333 would likely produce the following phenotypes:

  • Disrupted membrane domain organization: CASP knockout mutants show disorganized lignin microdomains . While correctly positioned lignin microdomains can still form in CASP mutants, they display ultrastructural abnormalities .

  • Excessive cell wall growth: CASP mutants exhibit aberrant cell wall deposition at Casparian strip domains .

  • Loss of exclusion zones: The characteristic membrane protein exclusion seen in wild-type CASP domains is compromised in mutants .

  • Impaired exocyst dynamics: CASP proteins influence the localization and function of exocyst components, so mutations would likely disrupt normal vesicle tethering and fusion processes .

  • Reduced membrane-cell wall adhesion: CASP-marked membranes display matrix adhesion properties that would be impaired in mutants .

When designing experiments to characterize ARALYDRAFT_492333 mutants, researchers should employ complementation studies with the wild-type gene to confirm phenotype specificity, and consider creating partial loss-of-function alleles to identify potentially separate functions of different protein domains.

How is ARALYDRAFT_492333 related evolutionarily to other CASP proteins across plant species?

ARALYDRAFT_492333 is part of a larger family of CASP-like (CASPL) proteins that have been identified across plant species. Evolutionary analysis of CASPLs has revealed:

  • Ancient origin: CASP-like proteins are present in green algae, suggesting an ancient origin predating land plant evolution . Six proteins with sequence similarity to CASPs were identified in green algae .

  • Expansion in land plants: The CASPL family expanded significantly during land plant evolution, with over 350 proteins annotated from more than 50 plant species .

  • Functional specialization: Some CASPLs have evolved specialized functions in the endodermis. These specialized members often contain a distinctive nine-amino acid signature (ESLPFFTQF) in the first extracellular loop .

  • Regulatory conservation: The regulatory elements controlling CASP expression appear to be conserved across species. For example, a 2-kb genomic fragment upstream of a Lotus japonicus CASP gene was sufficient to drive expression in the Arabidopsis endodermis .

  • Absence in early land plants: Interestingly, CASP homologs with the nine-amino acid endodermis-specific signature are absent in Physcomitrella patens and Selaginella moellendorffii, suggesting this specialized function evolved later .

Given these evolutionary patterns, ARALYDRAFT_492333 likely represents a specialized adaptation in Arabidopsis lyrata for endodermal barrier formation. Comparative studies with homologs from other species could provide insights into both conserved functions and species-specific adaptations.

What selective pressures might have shaped the evolution of ARALYDRAFT_492333 in Arabidopsis lyrata?

Several selective pressures likely shaped the evolution of ARALYDRAFT_492333 and related CASP proteins in Arabidopsis lyrata:

  • Root barrier function: The primary function of Casparian strips is to create apoplastic diffusion barriers in roots, controlling the selective uptake of nutrients and water while preventing the entry of pathogens . This fundamental role in plant survival would exert strong selective pressure for functional conservation.

  • Adaptation to soil conditions: Different soil environments might select for variations in CASP protein function to optimize nutrient uptake while preventing toxicity. Arabidopsis lyrata typically grows in rocky, nutrient-poor soils, which may have selected for specific adaptations in its CASP proteins.

  • Interaction with other proteins: CASP proteins interact with multiple partners, including Rab-GTPases and exocyst components . Co-evolution with these interaction partners could drive sequence changes in ARALYDRAFT_492333.

  • Tissue-specific expression: The regulatory elements controlling CASP expression appear to be under selection pressure, maintaining endodermis-specific expression across diverse plant species .

  • Linkage disequilibrium effects: In Arabidopsis lyrata, certain genomic regions show unusual patterns of genetic diversity and linkage disequilibrium . While not directly linked to ARALYDRAFT_492333 in the search results, such population genetic forces could influence its evolution.

Research examining sequence variation of ARALYDRAFT_492333 across different Arabidopsis lyrata populations from diverse habitats could help identify specific adaptive changes that might correlate with environmental conditions.

What are the optimal conditions for expressing and purifying recombinant ARALYDRAFT_492333 protein?

Based on the available information about recombinant ARALYDRAFT_492333 and general principles for membrane protein expression, the following methodological considerations are important:

These methodological considerations should be optimized for ARALYDRAFT_492333 specifically through empirical testing.

What functional assays can be used to characterize ARALYDRAFT_492333 activity in vitro?

Several functional assays can be employed to characterize the activity of recombinant ARALYDRAFT_492333 in vitro:

  • Protein-protein interaction assays:

    • Pull-down assays using His-tagged ARALYDRAFT_492333 to identify interaction partners

    • Surface plasmon resonance (SPR) to measure binding kinetics with suspected partners

    • Yeast two-hybrid or split-ubiquitin assays for membrane protein interactions

    • Microscale thermophoresis for quantitative interaction studies

  • Membrane association studies:

    • Liposome binding assays to test membrane integration capability

    • Fluorescence-based assays using labeled liposomes to measure membrane domain formation

    • Atomic force microscopy to visualize protein-induced changes in membrane organization

  • Cell wall component binding assays:

    • In vitro binding assays with purified cell wall components (cellulose, lignin precursors)

    • Isothermal titration calorimetry to determine binding affinities and thermodynamics

    • Fluorescence anisotropy to measure interactions with labeled cell wall components

  • Enzymatic activity tests:

    • While CASP proteins are not known to possess enzymatic activity, testing for potential roles in facilitating lignin polymerization might be relevant

    • Assays measuring changes in lignin precursor polymerization in the presence of ARALYDRAFT_492333

  • Structural studies:

    • Circular dichroism to analyze secondary structure in different membrane mimetics

    • NMR spectroscopy for structural analysis of specific domains

    • Cryo-electron microscopy if protein complexes can be isolated

These functional assays would provide insights into the molecular mechanisms by which ARALYDRAFT_492333 contributes to membrane domain formation and cell wall modification.

What are the potential applications of understanding ARALYDRAFT_492333 function for plant biotechnology?

Understanding ARALYDRAFT_492333 function could contribute to several plant biotechnology applications:

  • Enhanced nutrient uptake efficiency: Modifying CASP protein expression or function could potentially alter Casparian strip properties to optimize nutrient uptake in crops . This could lead to plants that require less fertilizer or can grow in nutrient-poor soils.

  • Improved stress tolerance: Casparian strips play critical roles in controlling ion movement into the vascular system . Enhanced control over this barrier function through CASP protein engineering could improve plant tolerance to salt stress, drought, or toxic soil elements.

  • Pathogen resistance: As components of a physical barrier that restricts pathogen entry, modified CASP proteins might contribute to enhanced disease resistance strategies.

  • Biofortification applications: Understanding how CASP proteins contribute to selective nutrient uptake could inform strategies for increasing the accumulation of beneficial minerals in edible plant parts.

  • Cell wall engineering: Insights into how CASP proteins modify cell walls could be applied to cell wall engineering for biofuel production or improved structural properties.

  • Synthetic biology approaches: The ability of CASP proteins to form specialized membrane domains could be exploited in synthetic biology applications, potentially creating novel compartmentalization systems in plants.

These applications would require detailed understanding of structure-function relationships in ARALYDRAFT_492333 and related proteins, as well as their integration with cellular signaling networks.

What outstanding questions remain about ARALYDRAFT_492333 function and regulation?

Several key questions remain to be addressed regarding ARALYDRAFT_492333:

  • Specific protein interactions: What are the specific protein-protein interactions of ARALYDRAFT_492333? Does it interact with the same Rab-GTPases and exocyst components identified for other CASP proteins ?

  • Regulation of expression: What transcription factors and signaling pathways regulate ARALYDRAFT_492333 expression? How does its expression respond to environmental stresses?

  • Post-translational modifications: Are there important post-translational modifications that regulate ARALYDRAFT_492333 function? Do these modifications change in response to environmental conditions?

  • Evolutionary adaptations: How has ARALYDRAFT_492333 evolved specifically in Arabidopsis lyrata compared to related species? Are there species-specific adaptations that correlate with ecological niches?

  • Membrane microdomain formation: What are the precise molecular mechanisms by which ARALYDRAFT_492333 contributes to membrane domain formation and protein exclusion ?

  • Functional redundancy: To what extent does ARALYDRAFT_492333 function redundantly with other CASP family members in Arabidopsis lyrata? Are there unique functions not shared with other family members?

  • Lignin deposition mechanisms: How exactly does ARALYDRAFT_492333 influence the localized deposition of lignin in Casparian strips ?

Addressing these questions will require integrated approaches combining structural biology, genetics, cell biology, and biochemistry, potentially leading to new insights into plant membrane biology and cell wall formation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.