Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_493322 (ARALYDRAFT_493322)

Shipped with Ice Packs
In Stock

Description

Functional Role in Plant Physiology

ARALYDRAFT_493322 is a homolog of Arabidopsis thaliana CASP proteins, which orchestrate Casparian strip (CS) formation in root endodermis. Key functions include:

  • Membrane domain scaffolding: Localizes to plasma membrane domains to block apoplastic diffusion, ensuring selective nutrient uptake .

  • Lignin deposition: Recruits peroxidases to polymerize lignin at CS sites, forming a barrier against pathogens and toxins .

  • Stress adaptation: CASP-like proteins modulate ion transport and responses to abiotic stresses (e.g., cold) .

Evolutionary Conservation

  • CASP proteins are conserved across land plants and green algae, with Arabidopsis lyrata CASPLs sharing structural motifs (e.g., extracellular loops) critical for membrane localization .

  • Phylogenetic analysis groups ARALYDRAFT_493322 within the CASPL1A subfamily, characterized by unique extracellular loop features .

Expression Patterns

  • RNA-seq data highlight elevated expression of CASPL genes (including ARALYDRAFT_493322) in root endodermal cells, correlating with CS formation .

  • AtCASP_like1/31 and OsCASP_like11/9 orthologs show similar root-specific expression, suggesting conserved roles in monocots and dicots .

Mutational Studies

  • Deletion of extracellular loops in CASPs disrupts membrane domain integrity, though transmembrane domains alone suffice for initial scaffolding .

  • Mutations in conserved residues (e.g., TM3 Asp134) impair protein folding, underscoring structural sensitivity .

Applications in Plant Science

  • Functional studies: Used to dissect CASP-mediated CS assembly and nutrient transport mechanisms .

  • Stress response models: Investigated in transgenic plants to explore roles in ion homeostasis and cold tolerance .

  • Protein interaction assays: Facilitate identification of binding partners (e.g., peroxidases) via His-tag affinity purification .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please specify your desired format in the order notes, and we will fulfill your requirements whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. To enhance long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference point.
Shelf Life
The shelf life of our proteins is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. For multiple use, aliquoting is essential. To maintain protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type preference, please communicate it to us, and we will prioritize fulfilling your request.
Synonyms
ARALYDRAFT_493322; CASP-like protein 1E1; AlCASPL1E1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)
Target Names
ARALYDRAFT_493322
Target Protein Sequence
MEHESKTKMDGIEMEKGKKENGSRKGVEITMRVLALVLTMVAATVLGVAKQTEVVPIKLI PTLPPLNVATTAKASYLSAFVYNICANAIACGYTAISIMIVIISKGRRSKCLLMAVLIGD LMMVALLCSSTGAAGAIGLMGRHGNKHVMWKKVCGVFGKFCNQAAVSVAITLIASVVFML LVVLDALKLP
Uniprot No.

Target Background

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of ARALYDRAFT_493322 and how does it relate to the CASP protein family?

ARALYDRAFT_493322 (also known as CASP-like protein 1E1 or AlCASPL1E1) is a 190-amino acid protein with a molecular weight of approximately 20.1 kDa that belongs to the Casparian strip membrane proteins (CASP) family . The protein contains four predicted transmembrane domains with cytoplasmic N and C termini, characteristic of CASP family members . Its amino acid sequence (MEHESKTKMDGIEMEKGKKENGSRKGVEITMRVLALVLTMVAATVLGVAKQTEVVPIKLIPTLPPLNVATTAKASYLSAFVYNICANAIACGYTAISIMIVIISKGRRSKCLLMAVLIGDLMMVALLCSSTGAAGAIGLMGRHGNKHVMWKKVCGVFGKFCNQAAVSVAITLIASVVFMLLVVLDALKLP) reveals conserved residues typical of the CASP family, particularly in the transmembrane domains TM1 and TM3 . Evolutionary analysis has shown that CASP-like proteins are conserved across plant species and share homology with the MARVEL protein family, with specific conserved residues located in the transmembrane domains that are likely involved in protein localization and function .

How has ARALYDRAFT_493322 evolved within the plant kingdom, and what does this reveal about Casparian strip development?

Phylogenetic analysis of CASP-like proteins across the plant kingdom has revealed significant evolutionary conservation, particularly in specific protein domains. Research has identified over 350 CASP homologs (termed CASPLs) from more than 50 plant species . The conservation pattern suggests that CASP proteins emerged as specialized membrane domain-forming proteins during the evolution of vascular plants. Notably, the appearance of Casparian strips in plants correlates with the emergence of a CASP-specific signature sequence that is absent in plant genomes lacking Casparian strips . This evolutionary pattern suggests that ARALYDRAFT_493322 and related proteins represent adaptations for specialized barrier formation in vascular plants. Six proteins with sequence similarity were identified in green algae, indicating an ancient evolutionary origin with subsequent specialization in land plants .

What experimental methods are most effective for studying ARALYDRAFT_493322 localization in plant tissues?

For studying ARALYDRAFT_493322 localization, fluorescent protein fusion techniques have proven most effective. Research approaches have successfully used GFP or mCherry fusion proteins expressed under native promoters to visualize protein localization at the Casparian strip domain (CSD) . For instance, researchers have used a wild-type AtCASP1-mCherry fusion as a reference to study protein localization . Promoter analysis is equally important - a 2-kb genomic fragment upstream of the translational start codon is typically sufficient to drive endodermis-specific expression . Comparative localization studies between wild-type and mutant proteins provide valuable insights into domain function. When studying CASP-like proteins across species, heterologous expression in Arabidopsis has been successful, as demonstrated by the expression of Lotus japonicus CASP homologs in Arabidopsis that perfectly recapitulated the localization pattern of endogenous AtCASP1 .

What are the technical challenges in producing functional recombinant ARALYDRAFT_493322 for in vitro studies?

Producing functional recombinant ARALYDRAFT_493322 presents several technical challenges due to its nature as a multi-pass membrane protein. Recombinant production typically requires expression in heterologous systems such as E. coli, as evidenced by commercially available recombinant proteins . Key challenges include maintaining proper protein folding and ensuring correct insertion of the four transmembrane domains. The protein requires careful handling to prevent aggregation and preserve functionality - repeated freeze-thaw cycles should be avoided, and the protein should be stored in appropriate buffers (such as Tris/PBS-based buffer with 6% Trehalose, pH 8.0) . Reconstitution procedures are critical; it is recommended to briefly centrifuge vials before opening and to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Addition of glycerol (5-50% final concentration) is advised for long-term storage at -20°C/-80°C .

How do specific amino acid residues in ARALYDRAFT_493322 contribute to its functional properties?

Specific amino acid residues in CASP family proteins, including ARALYDRAFT_493322, are crucial for their function. Particularly important are conserved residues in the transmembrane domains: an Arginine in TM1 and an Aspartate in TM3 are present in the vast majority of CASP-like proteins . Mutagenesis studies of the related AtCASP1 protein demonstrated that the conserved Asp residue in TM3 (corresponding to D134 in AtCASP1) is essential for correct protein folding, as mutations at this position (D134H) prevented proper protein expression . The extracellular loops also contain functionally important residues. In EL2, mutations of residues conserved across most CASP-like proteins affected protein localization to varying degrees. For example, mutations C168S, F174V, and C175S caused prolonged persistence at the lateral plasma membrane, while W164G had the strongest effect, being initially excluded from the CSD .

What is the importance of the extracellular loops in ARALYDRAFT_493322 for protein function and localization?

The extracellular loops of CASP-like proteins, including ARALYDRAFT_493322, play nuanced roles in protein function and localization. Research on the related AtCASP1 protein showed that while mutations in specific residues in EL2 affected localization, complete deletion of EL2 (Δ158:175) still allowed localization to the Casparian strip domain (CSD), although with faster signal fading than in wild-type proteins . Similarly, deletions of portions of EL1 (Δ72:80, Δ73:79, and Δ74:78) did not prevent CSD localization but resulted in longer persistence at lateral membranes and delayed enrichment at the CSD . This suggests the loops are not essential for basic localization but contribute to the efficient and stable establishment of protein at the CSD. Notably, EL1 contains a nine-amino acid signature (ESLPFFTQF) that is highly conserved in spermatophytes but absent in more primitive plants like Physcomitrella patens and Selaginella moellendorffii, suggesting a specialized function in higher plants .

How does ARALYDRAFT_493322 function compare with other CASP-like proteins across different plant species?

ARALYDRAFT_493322 (AlCASPL1E1) functions as part of the larger CASP family, which contains numerous members across plant species. Comparative analysis shows that CASP-like proteins from different species can perform similar functions when their key domains are conserved. For example, a CASP homolog from Lotus japonicus containing the nine-amino acid signature (ESLPFFTQF) in its first extracellular loop was able to perfectly recapitulate the localization pattern of endogenous AtCASP1 when expressed in Arabidopsis . This functional conservation extends to regulatory elements, as the L. japonicus promoter was sufficient to drive endodermis-specific expression in Arabidopsis . These findings suggest that ARALYDRAFT_493322 likely performs functions analogous to other CASP family members in forming specialized membrane domains and directing cell wall modifications, particularly in the context of Casparian strip formation.

What distinguishes ARALYDRAFT_493322 from other CASPL subfamilies in terms of expression patterns and tissue specificity?

While the search results don't provide specific information about ARALYDRAFT_493322's expression pattern, research on CASP family members indicates that different CASPL subfamilies show distinct expression patterns and tissue specificities. CASPs are primarily expressed in the endodermis where they form the Casparian strip domain (CSD) . The presence of specific regulatory elements in the promoter regions of CASP genes determines their tissue-specific expression. This is evidenced by the fact that a 2-kb genomic fragment upstream of the translational start codon of a Lotus japonicus CASP gene was sufficient to drive endodermis-specific expression in Arabidopsis . The conservation of both protein sequence and regulatory elements suggests that ARALYDRAFT_493322, as a member of the CASPL1 subfamily, likely shares the endodermis-specific expression pattern observed in other CASPL1 members, distinguishing it from CASPL proteins in other subfamilies that may be expressed in different tissues.

How can ARALYDRAFT_493322 be utilized in studies of membrane domain formation and cell wall modification?

ARALYDRAFT_493322 serves as an excellent model protein for studying specialized membrane domain formation and directed cell wall modification. Researchers can use tagged versions of the protein (such as GFP or mCherry fusions) to visualize the formation of membrane domains in real-time using confocal microscopy . The protein can also be used to study the interaction between membrane domain formation and cell wall modification processes. Since CASPs mediate the deposition of lignin and building of Casparian strips by interacting with secreted peroxidases, ARALYDRAFT_493322 can be employed in co-localization and co-immunoprecipitation studies to identify interaction partners involved in cell wall modification . Additionally, the protein can be used in comparative studies across species to understand the evolution of barrier formation in plants, as demonstrated by cross-species expression experiments with Lotus japonicus CASP in Arabidopsis .

What insights can mutational analysis of ARALYDRAFT_493322 provide about Casparian strip formation?

Mutational analysis of ARALYDRAFT_493322 can provide valuable insights into the molecular mechanisms of Casparian strip formation. By creating targeted mutations in conserved residues and domains, researchers can determine which parts of the protein are essential for localization, stability, and function. Previous studies with related CASP proteins have shown that mutations in transmembrane domains can affect protein folding (e.g., D134H mutation in AtCASP1), while mutations in extracellular loops can alter localization dynamics and stability at the Casparian strip domain . Deletion studies have demonstrated that while extracellular loops are dispensable for basic localization, they contribute to the efficient establishment and stability of the protein at the CSD . Similar approaches with ARALYDRAFT_493322 would allow researchers to map the functional domains of the protein and understand their specific contributions to Casparian strip formation in Arabidopsis lyrata.

What are the optimal conditions for expression and purification of recombinant ARALYDRAFT_493322?

Optimal expression of recombinant ARALYDRAFT_493322 has been achieved in E. coli systems, though expression is also possible in cell-free expression systems . For purification, His-tagging is commonly employed, allowing for affinity chromatography-based isolation . The purified protein typically achieves greater than 90% purity as determined by SDS-PAGE . For storage, a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 has been found to maintain protein stability . It is recommended to store the protein at -20°C/-80°C, with aliquoting necessary to avoid repeated freeze-thaw cycles that can compromise protein integrity . For reconstitution, it is recommended to centrifuge the vial briefly before opening and to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Addition of 5-50% glycerol (with 50% being typical) is advised for long-term storage .

What quality control measures are essential to ensure functional integrity of purified ARALYDRAFT_493322?

Essential quality control measures for purified ARALYDRAFT_493322 include SDS-PAGE analysis to confirm protein purity (greater than 90% purity is the standard) . Verification of protein identity through mass spectrometry or western blotting with specific antibodies is also recommended. For functional integrity assessment, secondary structure analysis using circular dichroism spectroscopy can confirm proper protein folding. Since ARALYDRAFT_493322 is a membrane protein, its functionality may be assessed through reconstitution in artificial membrane systems followed by functional assays. Storage conditions must be carefully controlled to maintain integrity - the protein should be stored in appropriate buffer conditions (Tris/PBS-based buffer with 6% Trehalose, pH 8.0) and at recommended temperatures (-20°C/-80°C) . Working aliquots may be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can compromise protein structure and function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.