Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_493323 (ARALYDRAFT_493323)

Shipped with Ice Packs
In Stock

Description

Protein Overview

ARALYDRAFT_493323 is a recombinant protein belonging to the Casparian strip membrane domain (CASP) family, expressed in E. coli with an N-terminal His tag . Key specifications include:

PropertyDetail
UniProt IDD7MAF6
SpeciesArabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)
Protein LengthFull-length (1-190 amino acids)
Molecular Weight~21.7 kDa (calculated)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Functional Insights

ARALYDRAFT_493323 is implicated in:

  • Casparian Strip Formation: CASP proteins mediate lignin deposition in root endodermal cells, critical for nutrient transport and stress adaptation .

  • Stress Responses: Orthologs like AtCASPL4C1 in Arabidopsis thaliana regulate cold tolerance and growth dynamics .

  • Membrane Domain Organization: CASP-like proteins localize to plasma membranes, suggesting roles in subdomain specialization .

Key Findings from Comparative Studies:

StudyObservation
Rice vs. Arabidopsis CASPOsCASP_like11/9 and AtCASP_like1/31 show root-specific expression, linking them to Casparian strip development .
AtCASPL4C1 Knock-OutEnhanced cold tolerance and accelerated growth in Arabidopsis .

Expression and Purification

  • Host System: E. coli .

  • Tag: His tag for affinity chromatography .

  • Reconstitution: Solubilize in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage at -80°C .

Research Applications

  • Immunoassays: Available as an ELISA-ready recombinant protein .

  • Functional Studies: Used to investigate ion transport defects (e.g., OsCASP_like2/3/13/17/21/30) .

  • Protein-Protein Interaction Screening: Compatible with yeast two-hybrid and pull-down assays .

Comparative Analysis of CASP Homologs

GeneSpeciesFunctionExpression
ARALYDRAFT_493323A. lyrataMembrane domain organizationRoot endodermis
AtCASPL4C1A. thalianaCold stress response, growth regulationVascular tissues
ClCASPLCitrullus lanatusCold tolerance modulationPlasma membrane

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please contact your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ARALYDRAFT_493323; CASP-like protein 1E2; AlCASPL1E2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)
Target Names
ARALYDRAFT_493323
Target Protein Sequence
MENEGKNNMNGMEMEKGKRESRSRKGVELTMRVLALVLTMAAATVLGVAKQTKVVSIKLI PALPPLDITTTAKASYLSAFVYNISANAIACGYTAISIAILMISRGRRSKKLLMAVLLGD LVMVALLFSGTGAASAIGLMGLQGNKHVMWNKVCGVFGKFCHRAAPSLPLTFLAAVVFMF LVVLDAIKLP
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant CASP-like proteins?

Several expression systems have proven effective for producing recombinant CASP-like proteins, each with specific advantages depending on research needs:

Expression SystemAdvantagesTypical YieldPurification Methods
Cell-Free ExpressionRapid production, suitable for membrane proteins, avoids toxicity issuesVariable (typically μg scale)His-tag affinity chromatography
E. coliCost-effective, high yield, well-established protocols1-10 mg/LIMAC, size exclusion chromatography
Yeast (P. pastoris)Post-translational modifications, proper folding0.5-5 mg/LNi-NTA, ion exchange chromatography
BaculovirusComplex eukaryotic proteins, post-translational modifications1-50 mg/LAffinity chromatography
Mammalian CellHighest fidelity for eukaryotic proteins0.1-1 mg/LAffinity purification

For CASP-like protein ARALYDRAFT_493323 specifically, cell-free expression systems have been successfully employed to achieve ≥85% purity as determined by SDS-PAGE . This approach is particularly effective for membrane proteins that might be toxic when overexpressed in living cells. For structural studies requiring higher yields, E. coli or yeast expression systems may be preferable, though optimization of detergents is critical for maintaining protein stability during purification .

What are the optimal storage conditions for recombinant CASP-like proteins?

Proper storage is critical for maintaining the structural integrity and functionality of recombinant CASP-like proteins:

For short-term storage (up to one week), recombinant CASP-like protein ARALYDRAFT_493323 can be stored at 4°C in working aliquots . For extended preservation, the protein should be stored at -20°C or -80°C in a Tris-based buffer containing 50% glycerol, specifically optimized for this protein .

To minimize protein degradation and denaturation:

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

  • Store the protein in small aliquots (20-50 μL) to reduce the need for repeated thawing

  • Include protease inhibitors in the storage buffer if degradation is observed

  • Add reducing agents like DTT (1 mM) or β-mercaptoethanol if the protein contains disulfide bonds

  • Ensure the pH of the storage buffer is optimized (typically pH 7.4-8.0 for most recombinant proteins)

When thawing, allow the protein to warm gradually on ice rather than at room temperature to prevent localized heating that could denature protein domains .

How do CASP-like proteins from Arabidopsis lyrata compare functionally to their orthologs in Arabidopsis thaliana?

CASP-like proteins show significant functional conservation between Arabidopsis lyrata and Arabidopsis thaliana, but with notable distinctions that reflect evolutionary adaptation and specialization:

FeatureA. lyrata CASP-like proteinsA. thaliana CASP-like proteinsFunctional Implications
Gene DistributionARALYDRAFT_477942, ARALYDRAFT_493323 identified CASP1-5 and 34 additional CASP-like proteins Greater functional diversification in A. thaliana
Membrane LocalizationPlasma membrane domainsPlasma membrane domains at Casparian stripsConserved subcellular targeting
Tissue ExpressionRoot endodermis (primarily)Root endodermis-specific for CASP1-5; others varyTissue-specific roles maintained across species
Functional RoleCell wall-membrane attachmentExtracellular barrier formation, protein exclusion zonesCore functional conservation

While both species' CASP proteins share the fundamental role in Casparian strip formation, studies on A. thaliana have revealed that CASP proteins enforce displacement of initial secretory foci through exclusion of vesicle tethering factors, ensuring effective sealing of the cell wall space . Knockout studies in A. thaliana using the quintuple mutant (caspQ) show that CASPs are crucial for organizing, rather than localizing, lignification processes .

What experimental approaches can be used to study CASP-like protein interactions with cell wall components?

Multiple complementary techniques can be employed to characterize the complex interactions between CASP-like proteins and cell wall components:

  • Proximity-based labeling techniques

    • BioID or TurboID fusions with CASP proteins can identify proximal interacting partners at the cell wall-membrane interface

    • These techniques have successfully identified RabA-GTPases as CASP-interactors, revealing their localization and function at the CSD (Casparian Strip Domain)

  • Advanced microscopy approaches

    • Transmission electron microscopy with CeCl₃ precipitation has revealed that CASP proteins restrict ROS production within specific membrane foci

    • FRET-FLIM microscopy can quantify direct protein-protein interactions in vivo

    • Super-resolution techniques (STORM, PALM) can visualize nanoscale organization of CASP domains

  • Biochemical methods

    • Co-immunoprecipitation coupled with mass spectrometry to identify protein complexes

    • Liposome binding assays to study membrane attachment properties

    • Surface plasmon resonance (SPR) for quantitative binding kinetics

  • Functional assays

    • Plasmolysis experiments with hyperosmotic solutions (0.8M Mannitol) to assess membrane-cell wall attachments, as demonstrated in wild-type vs. caspQ mutants

    • Complementary protein exclusion visualization using fluorescent markers (e.g., mCitrine-SYP122) combined with Propidium Iodide staining

    • Diffusion barrier assays measuring penetration of molecules like Propidium Iodide into central vasculature

These approaches can be combined to develop a comprehensive understanding of how CASP-like proteins, including ARALYDRAFT_493323, mediate the formation of specialized membrane domains that interface with cell wall components during Casparian strip development.

How can CRISPR-Cas9 technology be optimized for generating knockouts of CASP-like genes for functional studies?

CRISPR-Cas9 editing provides powerful approaches for studying CASP-like protein function, with several optimization strategies particularly relevant for these membrane proteins:

Guide RNA Design Considerations:

  • Target conserved exonic regions that encode transmembrane domains essential for function

  • For multiplexed editing, as demonstrated for CASP1, CASP2, and CASP4 in A. thaliana, design two gRNAs per gene to increase editing efficiency

  • Avoid regions with secondary structure in the gRNA that could reduce Cas9 binding efficiency

  • Use gRNA design tools that account for plant codon usage and minimize off-target effects

Delivery Methods for Arabidopsis:

  • Agrobacterium-mediated transformation: Standard for stable transformation but less efficient for membrane proteins

  • Protoplast transformation: Allows rapid screening of gRNA efficiency before stable transformation

  • Ribonucleoprotein (RNP) complex delivery: Reduces off-target effects and avoids transgene integration

Screening Strategy:

  • Design PCR primers that flank the target region to detect deletions

  • Implement high-throughput sequencing to identify small indels

  • For functional validation, use fluorescent markers like mCitrine-SYP122 to assess protein exclusion zones

  • Employ PI staining to evaluate Casparian strip integrity and barrier function

Validation Approaches:

  • Complementation assays with wild-type and modified versions of the target gene

  • Phenotypic analysis including plasmolysis experiments to assess membrane-wall attachments

  • Transmission electron microscopy to examine ultrastructural changes in Casparian strips

A successful example from the literature is the generation of the caspQ mutant in A. thaliana, which combined T-DNA insertion alleles (casp3-1 casp5-1) with CRISPR-Cas9 targeting of the remaining CASP genes, resulting in deletion and frame-shift mutations . This approach revealed that CASPs are not required for localization of lignification enzymes but are crucial for organizing their activity and forming protein exclusion zones .

What roles do post-translational modifications play in CASP-like protein function?

Post-translational modifications (PTMs) significantly influence CASP-like protein function, affecting their localization, interactions, and regulatory capabilities:

PTM TypeFunction in CASP ProteinsDetection MethodsBiological Significance
PhosphorylationRegulates protein-protein interactions and membrane targetingPhosphoproteomics, Pro-Q Diamond stainingControls assembly of CASP complexes at membrane domains
UbiquitinationRegulates protein turnover and endocytic recyclingUbiquitin pull-down, Western blotMaintains appropriate CASP levels at the Casparian strip membrane domain
S-acylationEnhances membrane associationClick chemistry, metabolic labelingCritical for stable anchoring to specific membrane microdomains
GlycosylationAffects protein folding and stabilityGlycoprotein staining, mass spectrometryMay influence protein-cell wall interactions

For CASP-like protein ARALYDRAFT_493323 specifically, the amino acid sequence contains multiple potential modification sites, including:

  • Seven serine residues that could be phosphorylated (positions 23, 26, 44, 77, 104, 123, 160)

  • Two threonine residues (positions 51, 79) that may serve as phosphorylation sites

  • Four lysine residues that could be ubiquitinated (positions 17, 22, 51, 111)

Research approaches to study these modifications include:

  • Site-directed mutagenesis of putative modification sites followed by functional assays

  • Phosphomimetic mutations (S/T → D/E) to study constitutive phosphorylation effects

  • Non-phosphorylatable mutations (S/T → A) to study loss of phosphorylation

  • Immunoprecipitation followed by mass spectrometry to identify in vivo modifications

Understanding these PTMs is particularly relevant for CASP proteins since they must organize into specific membrane domains and exclude other proteins while maintaining cell wall attachments—processes likely regulated by dynamic modifications .

How can advanced imaging techniques be applied to study CASP-like protein dynamics in vivo?

Advanced imaging techniques offer powerful approaches to visualize and quantify CASP-like protein dynamics in living plant tissues:

Fluorescence Recovery After Photobleaching (FRAP)

  • Provides quantitative measurements of CASP protein mobility within membrane domains

  • Can determine the fraction of mobile vs. immobile protein populations

  • Useful for comparing wild-type CASP dynamics with mutant variants

  • Implementation: Express ARALYDRAFT_493323 fused to mCitrine or GFP under native promoter; photobleach a small region and monitor fluorescence recovery over time

Single-Particle Tracking (SPT)

  • Tracks individual CASP protein molecules with nanometer precision

  • Reveals diffusion characteristics and confinement zones

  • Implementation: Use photoactivatable fluorescent proteins (PA-GFP) fused to CASP proteins for sparse labeling and tracking

Förster Resonance Energy Transfer (FRET)

  • Detects protein-protein interactions between CASP proteins and potential partners

  • Can monitor conformational changes during membrane domain formation

  • Implementation: Create donor-acceptor pairs (e.g., CFP-YFP) between CASP proteins and suspected interaction partners

Lattice Light-Sheet Microscopy

  • Provides high-speed 3D imaging with minimal phototoxicity

  • Ideal for capturing dynamic processes during Casparian strip formation

  • Implementation: Express fluorescently tagged CASP proteins and image developing endodermal cells over time

Correlative Light and Electron Microscopy (CLEM)

  • Combines fluorescence imaging with ultrastructural details

  • Can correlate CASP protein localization with membrane-wall attachments

  • Implementation: Use fluorescent CASP fusion proteins with subsequent processing for electron microscopy

For CASP-like protein ARALYDRAFT_493323, these methods can address key questions:

  • How do CASP proteins transition from initial dispersed localization to concentrated membrane domains?

  • What is the sequence of protein recruitment during Casparian strip formation?

  • How does CASP mobility change upon interaction with cell wall components?

Studies in A. thaliana have already revealed that CASP proteins form exclusion zones visualized by complementary localization with Propidium Iodide staining, and imaging during plasmolysis has demonstrated their role in membrane-wall attachments . Similar approaches can be applied to A. lyrata CASP-like proteins to determine conservation of these dynamic processes.

What purification strategies maximize yield and maintain activity of recombinant CASP-like proteins?

Purifying membrane proteins like CASP-like protein ARALYDRAFT_493323 requires specialized approaches to maintain structure and function:

Optimized Purification Protocol:

  • Cell Lysis and Membrane Extraction

    • For cell-free expression systems, directly proceed to detergent solubilization

    • For E. coli or yeast, use mechanical disruption (French press, sonication) in buffer containing protease inhibitors

    • Isolate membrane fractions via ultracentrifugation (100,000 × g, 1 hour)

  • Detergent Screening and Solubilization

    • Test panel of detergents: DDM, LMNG, CHAPS, Fos-choline-12

    • Typical conditions: 1% detergent, 4°C, gentle rotation for 2-3 hours

    • Centrifuge (100,000 × g, 30 min) to remove insoluble material

  • Affinity Chromatography

    • Immobilized metal affinity chromatography (IMAC) using His-tag

    • Wash extensively with buffer containing 0.05-0.1% detergent

    • Elute with imidazole gradient (50-500 mM)

  • Secondary Purification

    • Size exclusion chromatography to remove aggregates and achieve ≥85% purity

    • Consider ion exchange chromatography for further purification

  • Quality Control

    • SDS-PAGE to verify purity (target: ≥85%)

    • Dynamic light scattering to assess homogeneity

    • Circular dichroism to confirm secondary structure

Critical Parameters for CASP-like Proteins:

  • Maintain pH between 7.0-8.0 throughout purification

  • Include glycerol (10-20%) in all buffers to stabilize membrane proteins

  • Consider adding specific lipids (POPC, POPE) during purification to maintain native-like environment

  • For long-term storage, flash-freeze in liquid nitrogen and store at -80°C in buffer containing 50% glycerol

These methodological approaches have been successfully used to purify CASP-like proteins to ≥85% purity as determined by SDS-PAGE , making them suitable for functional and structural studies.

How can protein engineering be used to modify CASP-like protein functionality?

Protein engineering offers strategic approaches to modify and study CASP-like proteins:

Domain Swapping Strategies:

  • Exchange transmembrane domains between different CASP family members to investigate domain-specific functions

  • Create chimeric proteins between A. lyrata and A. thaliana CASP proteins to identify species-specific functional elements

  • Swap protein exclusion domains to understand the molecular basis of protein segregation at membrane domains

Site-Directed Mutagenesis Applications:

  • Mutate conserved residues in the ARALYDRAFT_493323 sequence to identify critical functional sites:

    • Target the highly conserved transmembrane regions

    • Modify charged residues that may be involved in protein-protein interactions

    • Alter potential lipid-binding sites to investigate membrane association

  • Create phosphomimetic (S/T → D/E) or non-phosphorylatable (S/T → A) mutants to study regulation by phosphorylation

Fusion Protein Approaches:

  • Generate split fluorescent protein complementation constructs to study CASP protein dimerization

  • Create proximity labeling fusions (BioID, TurboID) to identify interacting partners at the membrane-wall interface

  • Develop optogenetic variants with light-inducible dimerization domains to control CASP localization temporally

Expression Optimization:

  • Codon optimization for heterologous expression systems

  • Addition of solubility-enhancing tags (SUMO, MBP) with precision protease cleavage sites

  • Integration of purification tags positioned to minimize functional interference

Engineered CASP proteins can be tested functionally by complementation assays in the caspQ mutant background, which displays compromised extracellular barrier function, abnormal ROS distribution, and lack of protein exclusion zones . Successful engineering would restore these functions, providing insight into structure-function relationships of CASP-like proteins.

What bioinformatics approaches can predict functional domains in CASP-like proteins?

Computational analysis provides valuable insights into CASP-like protein structure and function:

Sequence-Based Analysis:

  • Transmembrane Domain Prediction

    • TMHMM and TOPCONS predict ARALYDRAFT_493323 contains 4 transmembrane helices

    • These domains are critical for membrane integration and protein exclusion functions

  • Conserved Motif Identification

    • MEME suite analysis identifies conserved motifs shared among CASP family members

    • Alignment of 39 CASP-LIKES family members reveals signature sequences for membrane domain organization

  • Post-translational Modification Sites

    • NetPhos predicts 7 potential phosphorylation sites in ARALYDRAFT_493323

    • UbPred identifies 4 potential ubiquitination sites that may regulate protein turnover

Structural Prediction:

  • AlphaFold2/RoseTTAFold Models

    • Predict tertiary structure with particular focus on transmembrane bundle arrangement

    • Identify potential interaction surfaces and lipid-binding regions

  • Molecular Dynamics Simulations

    • Simulate CASP protein behavior in membrane environments

    • Predict conformational changes during membrane domain formation

Evolutionary Analysis:

  • Phylogenetic Profiling

    • Places ARALYDRAFT_493323 within evolutionary context of 39 CASP-LIKES family members

    • Identifies lineage-specific adaptations versus conserved functional domains

  • Co-evolution Analysis

    • Detects residue pairs that co-evolve, suggesting functional coupling

    • Predicts protein-protein interaction sites based on correlated mutations

Protein-Protein Interaction Prediction:

  • Interactome Analysis

    • Predicts interactions with RabA-GTPases and exocyst subunits based on A. thaliana data

    • Generates testable hypotheses for experimental validation

These bioinformatic approaches provide a foundation for experimental design, helping researchers target specific domains and residues for functional characterization of CASP-like proteins like ARALYDRAFT_493323.

How can knowledge of CASP-like proteins from Arabidopsis be translated to crop improvement?

The fundamental understanding of CASP-like proteins gained from Arabidopsis research offers several promising avenues for crop improvement:

Enhanced Nutrient Use Efficiency:

  • Modifying CASP expression could fine-tune Casparian strip permeability to optimize nutrient uptake in crops

  • Targeted engineering of CASP proteins could enhance nitrogen and phosphorus acquisition in low-fertility soils

  • Research in Arabidopsis has established that CASP proteins are crucial for forming extracellular diffusion barriers that regulate nutrient transport

Improved Water Use Efficiency:

  • Strategic modifications of CASP function could optimize water uptake and retention

  • Enhanced Casparian strips could reduce uncontrolled water loss during drought stress

  • Translating findings from Arabidopsis to crops requires understanding orthologous CASP functions in species like rice, wheat, and maize

Stress Resistance Development:

  • Reinforced Casparian strips through CASP engineering could improve resistance to salt and heavy metal stresses

  • Modified cell wall-membrane attachments might enhance mechanical resistance to pathogen invasion

Translational Approaches from Arabidopsis to Crops:

  • Identify orthologous CASP genes in crop species through comparative genomics

  • Characterize expression patterns in crop root tissues using transcriptomics

  • Generate targeted modifications using CRISPR-Cas9 based on Arabidopsis functional data

  • Develop crop-specific promoters for precise spatiotemporal expression

The extensive knowledge base developed in Arabidopsis provides a robust framework for translating CASP function discoveries to crops, as Arabidopsis research has proven valuable for translational applications in agriculture . The fundamental discoveries about CASP proteins' roles in forming protein exclusion zones and organizing lignification processes provide mechanistic insights that can guide precision crop engineering.

What emerging technologies will advance our understanding of CASP-like protein function?

Several cutting-edge technologies hold promise for deepening our understanding of CASP-like protein function:

Cryo-Electron Microscopy (Cryo-EM):

  • Could resolve the high-resolution structure of CASP protein complexes in membrane environments

  • May reveal how CASP proteins associate to form exclusion domains and interact with cell wall components

  • Challenges include purifying sufficient quantities of stable protein complexes

Single-Cell Transcriptomics and Proteomics:

  • Will provide unprecedented resolution of CASP expression dynamics during root development

  • Can identify cell-type specific co-expression networks to predict functional partners

  • May reveal regulatory mechanisms controlling CASP expression in response to environmental stimuli

Live-Cell Super-Resolution Microscopy:

  • Techniques like MINFLUX and 3D-STORM could visualize CASP domain formation at nanometer resolution

  • Will allow real-time visualization of protein exclusion processes described in A. thaliana studies

  • Could capture dynamic interactions between CASP proteins and vesicle tethering factors like RabA-GTPases

In vitro Reconstitution Systems:

  • Synthetic membrane systems with purified components to reconstitute CASP domain formation

  • Could test minimal requirements for CASP-mediated protein exclusion and membrane domain organization

  • May allow manipulation of membrane composition to study lipid influences on CASP function

Integrative Structural Biology:

  • Combining X-ray crystallography, NMR, SAXS, and computational modeling

  • Will provide comprehensive structural models of CASP proteins in native-like environments

  • Could reveal conformational changes during CASP complex assembly and membrane domain formation

These technologies will help address fundamental questions about how CASP proteins like ARALYDRAFT_493323 organize into domains that display protein exclusion and cell wall attachment properties, ultimately advancing our understanding of plant membrane biology and cell wall development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.