Recombinant Arabidopsis lyrata subsp. lyrata Casparian strip membrane protein ARALYDRAFT_478496 (ARALYDRAFT_478496)

Shipped with Ice Packs
In Stock

Description

Introduction to ARALYDRAFT_478496

ARALYDRAFT_478496 is a specialized membrane protein identified in Arabidopsis lyrata subsp. lyrata, commonly known as lyre-leaved rock-cress . This protein belongs to the Casparian strip membrane protein family and is specifically referred to as AlCASP2 (Arabidopsis lyrata Casparian Strip Protein 2) in scientific literature . Casparian strip membrane proteins are crucial components that form specialized domains in the plasma membrane of plant endodermal cells, playing a key role in establishing diffusion barriers that regulate water and nutrient uptake through plant roots .

The protein is officially cataloged in biological databases with the UniProt identifier D7LAP2, facilitating cross-reference across scientific resources and publications . As a full-length protein consisting of 204 amino acids, ARALYDRAFT_478496 represents an important structural component in the complex molecular architecture that establishes the endodermal barrier system in plant roots . This barrier system is critical for plant health as it allows selective absorption of nutrients while preventing the entry of harmful substances into the vascular system.

The recombinant form of this protein has been successfully produced and made commercially available for research purposes, typically featuring an N-terminal His-tag to facilitate purification and experimental applications . The availability of this recombinant protein enables detailed investigations into its structure, function, and potential applications in plant biology and biotechnology.

Recombinant Production of ARALYDRAFT_478496

The recombinant production of ARALYDRAFT_478496 represents an important technological achievement that facilitates research into this membrane protein. According to product specifications, the recombinant protein has been successfully expressed in Escherichia coli expression systems . The full-length protein (amino acids 1-204) is produced with an N-terminal His-tag, which serves as an affinity tag for purification purposes .

The specifications of the commercially available recombinant ARALYDRAFT_478496 are summarized in the following table:

CharacteristicSpecification
SpeciesArabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)
SourceE. coli
TagN-terminal His
Protein LengthFull Length (1-204 amino acids)
FormLyophilized powder
PurityGreater than 90% (determined by SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Recommended Storage-20°C/-80°C

For optimal handling and use of the recombinant protein, specific protocols are recommended. Prior to opening, the vial should be briefly centrifuged to bring the contents to the bottom . Reconstitution should be performed in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . For long-term storage, addition of 5-50% glycerol (final concentration) is recommended, with 50% being the default concentration suggested by suppliers . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided to maintain protein integrity .

In addition to standard commercial sources, custom recombinant production services for ARALYDRAFT_478496 are available through specialized biotechnology companies . These services offer various expression systems beyond E. coli, including yeast, mammalian, and insect cell systems, with different fusion expression options such as His Tag, FLAG Tag, MBP, GST, trxA, Nus, Biotin, and GFP tags . This flexibility allows researchers to obtain custom-designed recombinant proteins optimized for specific experimental requirements.

Applications and Research Potential

Recombinant ARALYDRAFT_478496 offers numerous applications in plant biology research, particularly in studies focused on root development and nutrient uptake mechanisms. The availability of purified recombinant protein enables detailed investigations into the molecular mechanisms underlying Casparian strip formation and function.

One primary application involves functional characterization studies. By utilizing the recombinant protein in biochemical assays, researchers can investigate the specific interactions between ARALYDRAFT_478496 and other cellular components, particularly peroxidases involved in lignin deposition . These studies can provide insights into how this protein contributes to the formation of diffusion barriers in plant roots.

Structural biology represents another important application area. The purified recombinant protein can be used in crystallization trials or other structural determination methods to elucidate the three-dimensional architecture of ARALYDRAFT_478496. Such structural information would enhance understanding of how this protein integrates into the plasma membrane and forms specialized domains.

Immunological studies constitute a third application domain. The recombinant protein can serve as an antigen for generating specific antibodies against ARALYDRAFT_478496 . These antibodies can then be used in immunolocalization experiments to precisely determine the spatial distribution of the protein in plant tissues, as well as in co-immunoprecipitation studies to identify interaction partners.

Comparative biology studies represent yet another valuable application. By comparing the structure and function of ARALYDRAFT_478496 with homologous proteins from other plant species, researchers can gain insights into the evolution and adaptation of root barrier functions across different plant lineages and environments. This comparative approach could reveal conserved mechanisms as well as species-specific adaptations.

Finally, biotechnological applications may emerge from research on ARALYDRAFT_478496. Understanding how this protein contributes to water and nutrient uptake regulation could potentially inform strategies for developing crops with improved water use efficiency or enhanced nutrient acquisition capabilities, traits that are increasingly important in the context of climate change and sustainable agriculture.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: Our standard shipping includes normal blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ARALYDRAFT_478496; Casparian strip membrane protein 2; AlCASP2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)
Target Names
ARALYDRAFT_478496
Target Protein Sequence
MKNESTTIDVPAESSSAMKGKAPLIGVARDHTTSGSGGYNRGLSIFDFLLRLAAIVAALA AAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAMALVGGYLVLSLPISVVTILRPL ATAPRLLLLVLDTAVLALNTAAASSAAAISYLAHSGNQNTNWLPICQQFGDFCQKSSGAV VSAFISVVFFTILVVISGVALKRH
Uniprot No.

Target Background

Function
This protein regulates membrane-cell wall junctions and localized cell wall deposition. It is essential for establishing the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis. This modification creates an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm, preventing lateral diffusion.
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ARALYDRAFT_478496 and what is its biological significance?

ARALYDRAFT_478496 is a Casparian strip membrane protein found in Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress). It belongs to the CASP protein family, which plays a pivotal role in the formation of Casparian strips in the endodermis of plant roots. These strips function as paracellular barriers, analogous to tight junctions in animals, and are crucial for selective nutrient uptake, exclusion of pathogens, and regulation of water transport in plants . The protein is essential for establishing the plant's primary root-diffusion barrier, making it a significant focus in plant physiology research, particularly in understanding how plants respond to environmental stresses .

How are Casparian strip membrane proteins classified and organized?

Casparian strip membrane domain proteins (CASPs) are organized into distinct subgroups based on sequence homology and functional characteristics. Research has identified 41 OsCASP genes in rice and 39 AtCASP genes in Arabidopsis, which are categorized into six distinct subgroups . This classification helps researchers understand evolutionary relationships and predict functional roles. Collinearity analysis has revealed that whole-genome duplication (WGD) and tandem duplication (TD) events have driven the evolution of CASPs, with WGDs being the predominant mechanism . This classification system is essential for comparative studies and for understanding the specialized functions of different CASP proteins in plant development and stress responses.

What are the optimal methods for recombinant expression of ARALYDRAFT_478496?

For optimal recombinant expression of ARALYDRAFT_478496, E. coli-based expression systems have proven effective, as demonstrated by the successful production of His-tagged recombinant versions of the protein . The methodology involves:

  • Cloning the full-length coding sequence (nucleotides corresponding to amino acids 1-204) into an appropriate expression vector

  • Transformation into a suitable E. coli strain optimized for protein expression

  • Induction of protein expression under controlled conditions

  • Purification using affinity chromatography, leveraging the His-tag

  • Buffer optimization (typically Tris-based buffer with 50% glycerol) for protein stability

Researchers should consider expression temperature, induction time, and the choice of E. coli strain as critical variables affecting protein yield and solubility. For experimental applications requiring higher purity, additional purification steps such as size exclusion chromatography may be necessary.

How should storage and handling conditions be optimized for ARALYDRAFT_478496 experiments?

To maintain the structural integrity and functionality of recombinant ARALYDRAFT_478496, researchers should adhere to the following storage and handling guidelines:

  • Store the protein at -20°C for regular use, or at -80°C for extended storage periods

  • Prepare working aliquots to be kept at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as these can lead to protein degradation and loss of activity

  • Use a stabilizing buffer such as Tris-based buffer with 50% glycerol, which has been optimized for this specific protein

  • When conducting experiments, maintain the protein on ice when not in use

Proper storage and handling are critical for experimental reproducibility and reliability, particularly when conducting functional assays or structural studies with ARALYDRAFT_478496.

What experimental design considerations are crucial for studying ARALYDRAFT_478496 in the context of Casparian strip formation?

When designing experiments to study ARALYDRAFT_478496's role in Casparian strip formation, researchers should consider several key factors:

  • Selection of appropriate variables: Independent variables might include environmental stresses or genetic modifications, while dependent variables could include Casparian strip integrity, nutrient uptake efficiency, or gene expression levels .

  • Control conditions: Maintaining consistent growth conditions is essential, as Casparian strip formation is sensitive to environmental factors. This includes standardizing nutrient solutions, light cycles, temperature, and humidity .

  • Visualization techniques: Combining fluorescent protein tagging with confocal microscopy allows for in vivo observation of ARALYDRAFT_478496 localization. Alternative approaches include immunolocalization or histochemical staining to visualize Casparian strips .

  • Genetic manipulation: CRISPR/Cas9 or RNAi techniques can be employed to modify ARALYDRAFT_478496 expression, allowing for functional studies through loss-of-function or gain-of-function approaches .

  • Tissue-specific analysis: Given that CASP genes are highly expressed in roots, particularly in endodermal cells, experimental designs should incorporate tissue-specific sampling and analysis techniques .

These considerations ensure robust experimental outcomes and facilitate the mechanistic dissection of Casparian strip formation mediated by ARALYDRAFT_478496.

How can researchers differentiate between the roles of lignin and suberin in Casparian strip formation when studying ARALYDRAFT_478496?

Distinguishing between lignin and suberin contributions in Casparian strips requires specialized methodological approaches:

  • Temporal analysis: Conduct time-course experiments to track the expression of ARALYDRAFT_478496 alongside lignin and suberin biosynthesis genes. In Arabidopsis, research has demonstrated that suberin is produced significantly later than the initial formation of Casparian strips, indicating that lignin, not suberin, is the primary component of early Casparian strips .

  • Chemical inhibition studies: Apply specific inhibitors of lignin biosynthesis (such as piperonylic acid) or suberin biosynthesis (such as flufenacet) while monitoring ARALYDRAFT_478496 localization and Casparian strip integrity.

  • Monolignol feeding experiments: Supplement plants with labeled monolignols to track incorporation into Casparian strips, as previous research has shown that monolignol feeding and lignin-specific chemical analysis indicates the presence of archetypal lignin in Casparian strips .

  • Genetic approaches: Generate plants devoid of detectable suberin through genetic manipulation of suberin biosynthesis genes, then assess whether functional Casparian strips still form. Research has shown that such plants still establish functional Casparian strips, confirming lignin's primary role .

  • Chemical analysis: Employ lignin-specific analytical techniques such as thioacidolysis or nitrobenzene oxidation to characterize the composition of Casparian strips in plants with modified ARALYDRAFT_478496 expression.

These methods collectively provide a robust framework for elucidating the specific contribution of ARALYDRAFT_478496 to lignin-based Casparian strip formation, distinct from suberin-related processes.

What comparative genomics approaches can reveal evolutionary insights about ARALYDRAFT_478496 and related CASP proteins?

Comparative genomics provides valuable evolutionary insights into ARALYDRAFT_478496 and related CASP proteins through several methodological approaches:

These approaches collectively enable researchers to reconstruct the evolutionary history of ARALYDRAFT_478496 and related proteins, providing context for understanding their current functions and predicting potential functional adaptations.

How can expression profiling be utilized to understand the tissue-specific roles of ARALYDRAFT_478496?

Expression profiling of ARALYDRAFT_478496 can reveal its tissue-specific functions through several methodological approaches:

  • RNA-seq analysis: Comprehensive transcriptomic profiling across different tissues and developmental stages has revealed that most CASP genes, including those similar to ARALYDRAFT_478496, are highly expressed in roots, particularly in endodermal cells . This technique provides a global perspective on expression patterns.

  • Cell-type specific transcriptomics: Employing techniques such as laser capture microdissection or fluorescence-activated cell sorting (FACS) with tissue-specific promoters allows for the isolation of specific cell types (e.g., endodermal cells) for targeted expression analysis.

  • In situ hybridization: This technique enables the visualization of ARALYDRAFT_478496 mRNA in tissue sections, providing spatial information about expression patterns within complex tissues like roots.

  • Promoter-reporter constructs: Generating transgenic plants with ARALYDRAFT_478496 promoter driving expression of reporter genes (e.g., GFP, GUS) allows for visualization of promoter activity across tissues and developmental stages.

  • RT-qPCR validation: For targeted expression analysis, RT-qPCR can quantify ARALYDRAFT_478496 expression in specific tissues or under various environmental conditions. Research has demonstrated that certain CASP genes may be candidate genes for ion defect processes, highlighting their specialized functions .

Tissue TypeRelative Expression LevelPrimary Function
Root endodermisVery highCasparian strip formation
Root cortexLowSecondary barrier formation
Aerial tissuesMinimalSpecialized barrier functions
Vascular tissuesModerateTransport regulation

These methodologies collectively provide a comprehensive understanding of where and when ARALYDRAFT_478496 is expressed, informing hypotheses about its diverse physiological roles.

How does ARALYDRAFT_478496 contribute to plant responses to environmental stresses?

ARALYDRAFT_478496, as a Casparian strip membrane protein, plays a crucial role in mediating plant responses to various environmental stresses through several mechanisms:

  • Water stress response: By contributing to the formation of Casparian strips, ARALYDRAFT_478496 helps regulate water movement between the soil solution and the vascular system. Under drought conditions, proper Casparian strip formation is essential for maintaining water use efficiency and preventing excessive water loss .

  • Nutrient stress adaptation: Research has demonstrated that CASP proteins are involved in selective nutrient uptake, with certain CASP genes (including OsCASP_like2/3/13/17/21/30) potentially serving as candidate genes for ion defect processes . This suggests that ARALYDRAFT_478496 may participate in regulating nutrient acquisition during deficiency conditions.

  • Pathogen defense: The Casparian strip serves as a physical barrier against soil-borne pathogens, preventing their entry into the vascular system. ARALYDRAFT_478496's contribution to this barrier formation represents an important component of the plant's basal defense system .

  • Salt stress management: Properly formed Casparian strips are essential for controlling sodium uptake and translocation during salt stress. ARALYDRAFT_478496's role in establishing this barrier contributes to salt tolerance mechanisms.

  • Heavy metal exclusion: Casparian strips help prevent the indiscriminate uptake of toxic heavy metals. Research suggests that CASP proteins like ARALYDRAFT_478496 are involved in this exclusion mechanism, protecting plants from heavy metal toxicity.

Understanding these multifaceted roles provides insights into how ARALYDRAFT_478496 contributes to plant adaptation to changing environmental conditions, with implications for improving crop resilience in the face of climate change.

What are the methods for analyzing interactions between ARALYDRAFT_478496 and other proteins in the Casparian strip formation pathway?

Several methodological approaches can be employed to investigate protein-protein interactions involving ARALYDRAFT_478496:

  • Yeast two-hybrid (Y2H) screening: This technique can identify potential interaction partners of ARALYDRAFT_478496 from a library of plant proteins. Y2H has been widely used for initial identification of protein-protein interactions in CASP protein research .

  • Co-immunoprecipitation (Co-IP): Using antibodies specific to ARALYDRAFT_478496 or its epitope tag, researchers can precipitate the protein along with its interaction partners from plant cell extracts. This technique validates interactions in a near-native context.

  • Bimolecular Fluorescence Complementation (BiFC): By fusing ARALYDRAFT_478496 and potential interacting proteins with complementary fragments of a fluorescent protein, interactions can be visualized in planta through fluorescence microscopy when the fragments come together.

  • Förster Resonance Energy Transfer (FRET): This technique measures energy transfer between fluorophore-tagged proteins in close proximity, allowing for the detection of direct protein-protein interactions in living cells.

  • Pull-down assays: Using recombinant His-tagged ARALYDRAFT_478496 , researchers can perform pull-down assays to identify interacting proteins from plant extracts, followed by mass spectrometry for identification.

  • Proximity-dependent biotin identification (BioID): By fusing ARALYDRAFT_478496 to a biotin ligase, researchers can identify proteins in close proximity in vivo, which become biotinylated and can be subsequently purified and identified.

These complementary approaches provide a comprehensive toolkit for elucidating the interaction network of ARALYDRAFT_478496, critical for understanding its mechanistic role in Casparian strip formation.

How can researchers investigate the relationship between ARALYDRAFT_478496 expression and lignin deposition in Casparian strips?

Investigating the relationship between ARALYDRAFT_478496 expression and lignin deposition requires integrative methodological approaches:

  • Co-expression analysis: Correlate the expression patterns of ARALYDRAFT_478496 with genes involved in lignin biosynthesis (such as cinnamyl alcohol dehydrogenase or cinnamoyl-CoA reductase) using transcriptomic data. Research has shown that manipulating lignin biosynthesis abrogates Casparian strip formation, indicating a direct relationship .

  • Histochemical staining: Use lignin-specific stains (such as phloroglucinol-HCl or Basic Fuchsin) to visualize lignin deposition in wildtype plants versus those with altered ARALYDRAFT_478496 expression. This approach enables direct observation of changes in lignin patterns.

  • Immunolocalization: Employ dual immunolocalization with antibodies against ARALYDRAFT_478496 and lignin biosynthesis enzymes to determine spatial correlation at the subcellular level.

  • Inducible expression systems: Generate plants with inducible ARALYDRAFT_478496 expression and monitor subsequent changes in lignin deposition using both imaging and biochemical approaches.

  • Metabolic labeling: Apply labeled monolignol precursors to plants with varying levels of ARALYDRAFT_478496 expression to track incorporation into Casparian strips. Previous research demonstrated that monolignol feeding and lignin-specific chemical analysis indicates the presence of archetypal lignin in Casparian strips .

  • Biochemical quantification: Perform thioacidolysis or other lignin-specific analytical techniques to quantitatively assess lignin content and composition in plants with modified ARALYDRAFT_478496 expression.

These approaches collectively enable researchers to establish the causal relationship between ARALYDRAFT_478496 expression and lignin deposition in Casparian strips, advancing our understanding of the molecular mechanisms underlying barrier formation in plant roots.

What are the common challenges in purifying recombinant ARALYDRAFT_478496 and how can they be addressed?

Purification of recombinant ARALYDRAFT_478496 presents several technical challenges that researchers should anticipate and address:

  • Protein solubility issues: As a membrane-associated protein, ARALYDRAFT_478496 may have limited solubility. This can be addressed by:

    • Optimizing expression temperature (typically lower temperatures improve solubility)

    • Including appropriate detergents in lysis and purification buffers

    • Considering fusion proteins (such as MBP or SUMO) to enhance solubility

    • Using a His-tag approach, as this has been successfully employed for ARALYDRAFT_478496 purification

  • Protein stability concerns: To maintain stability during purification:

    • Use freshly prepared buffers with appropriate protease inhibitors

    • Perform all purification steps at 4°C

    • Include glycerol (50%) in storage buffer as documented for this protein

    • Avoid repeated freeze-thaw cycles by preparing appropriate working aliquots

  • Purification yield optimization: To maximize protein yield:

    • Test multiple E. coli expression strains to identify optimal hosts

    • Optimize induction conditions (IPTG concentration, induction time)

    • Consider auto-induction media for reliable expression

    • Scale up cultures appropriately based on required protein amounts

  • Functional activity preservation: To ensure the purified protein retains its native function:

    • Validate protein folding using circular dichroism or limited proteolysis

    • Perform functional assays to confirm biological activity

    • Store in conditions that preserve activity (e.g., -20°C for regular use, -80°C for extended storage)

These methodological considerations help overcome common technical hurdles in working with recombinant ARALYDRAFT_478496, facilitating downstream applications and experimental reproducibility.

How can researchers validate the specificity and effectiveness of antibodies against ARALYDRAFT_478496?

Validating antibodies against ARALYDRAFT_478496 requires rigorous testing through multiple methodological approaches:

  • Western blot analysis:

    • Test antibodies against recombinant ARALYDRAFT_478496 protein as a positive control

    • Compare wildtype plant samples with those overexpressing or lacking ARALYDRAFT_478496

    • Include appropriate negative controls (unrelated proteins) to confirm specificity

    • Perform peptide competition assays to verify epitope specificity

  • Immunohistochemistry validation:

    • Compare antibody staining patterns with the known expression pattern of ARALYDRAFT_478496 (primarily in root endodermal cells)

    • Perform parallel experiments with fluorescent protein-tagged ARALYDRAFT_478496 to confirm localization

    • Include negative controls (pre-immune serum, secondary antibody only)

    • Test antibody performance across different fixation and sample preparation methods

  • Cross-reactivity assessment:

    • Test against closely related CASP proteins to evaluate potential cross-reactivity

    • Perform immunoprecipitation followed by mass spectrometry to identify all proteins recognized by the antibody

    • Consider epitope mapping to identify the specific region recognized by the antibody

  • Reproducibility testing:

    • Validate antibody performance across different lots

    • Test in multiple experimental settings and plant growth conditions

    • Compare results between laboratories if possible

These validation steps ensure that experimental results obtained using antibodies against ARALYDRAFT_478496 are reliable and specific, contributing to the reproducibility and robustness of research findings.

What are the critical considerations for designing CRISPR/Cas9-mediated gene editing experiments targeting ARALYDRAFT_478496?

When designing CRISPR/Cas9 experiments to manipulate ARALYDRAFT_478496, researchers should consider several critical factors:

  • Guide RNA (gRNA) design:

    • Target conserved functional domains to maximize disruption of protein function

    • Use multiple bioinformatics tools to identify gRNAs with high on-target efficiency and minimal off-target effects

    • Consider targeting different regions of the gene to generate a range of alleles (e.g., knockout vs. functional domain disruption)

    • Avoid regions with high GC content or secondary structure that might reduce gRNA efficiency

  • Off-target analysis:

    • Perform comprehensive bioinformatic prediction of potential off-target sites

    • Consider whole-genome sequencing of edited lines to identify actual off-target modifications

    • Design experiments to include proper controls for distinguishing phenotypic effects of on-target vs. off-target modifications

  • Screening and validation strategies:

    • Design PCR primers flanking the target site for initial screening

    • Implement sequencing-based validation of mutations

    • Develop assays to confirm loss of ARALYDRAFT_478496 expression (RT-qPCR, Western blot)

    • Prepare functional assays to assess Casparian strip integrity in edited plants

  • Experimental controls:

    • Include wild-type controls grown under identical conditions

    • Generate multiple independent edited lines to control for position effects or off-target impacts

    • Consider complementation experiments to confirm that observed phenotypes are due to ARALYDRAFT_478496 disruption

  • Tissue-specific editing considerations:

    • Given that CASP genes are predominantly expressed in root endodermal cells , consider using endodermis-specific promoters to drive Cas9 expression for tissue-specific editing

    • Design appropriate screening methods for tissue-specific modifications

These methodological considerations ensure robust gene editing experiments targeting ARALYDRAFT_478496, facilitating mechanistic insights into its function in Casparian strip formation.

What emerging technologies could advance our understanding of ARALYDRAFT_478496 function in plant development?

Several cutting-edge technologies hold promise for elucidating ARALYDRAFT_478496 function:

  • Single-cell RNA sequencing (scRNA-seq): This technology would enable unprecedented resolution of ARALYDRAFT_478496 expression patterns at the single-cell level within the root endodermis, potentially revealing previously undetected cellular heterogeneity and contextual regulation.

  • Cryo-electron microscopy: High-resolution structural determination of ARALYDRAFT_478496 and its complexes could provide mechanistic insights into how it mediates Casparian strip formation and interacts with cell wall components.

  • Optogenetics: Developing light-inducible ARALYDRAFT_478496 variants would allow temporal and spatial control of protein function, enabling precise manipulation of Casparian strip formation in specific cells and developmental contexts.

  • CRISPR base editing and prime editing: These refined gene editing approaches would enable precise modifications to ARALYDRAFT_478496, allowing researchers to study the functional significance of specific amino acids and domains without introducing disruptive mutations.

  • Proximity labeling proteomics: Methods such as TurboID or APEX2 fused to ARALYDRAFT_478496 would facilitate comprehensive identification of its protein interactome in native conditions, revealing previously unknown interaction partners.

  • Live-cell super-resolution microscopy: Advanced imaging techniques would enable visualization of ARALYDRAFT_478496 dynamics and Casparian strip formation with unprecedented spatial and temporal resolution, revealing the mechanistic details of these processes.

These emerging technologies promise to advance our understanding of ARALYDRAFT_478496's multifaceted roles in plant development and stress responses, potentially opening new avenues for agricultural applications.

How might research on ARALYDRAFT_478496 contribute to improving crop resistance to environmental stresses?

Research on ARALYDRAFT_478496 has significant potential applications for enhancing crop resilience:

  • Drought tolerance engineering: Understanding how ARALYDRAFT_478496 contributes to Casparian strip formation could inform strategies to optimize water use efficiency in crops. Modifying CASP expression or activity might enable fine-tuning of water transport barriers in roots, enhancing drought tolerance without compromising nutrient uptake.

  • Salinity tolerance improvement: As Casparian strips regulate ion movement from soil into the vascular system, engineering ARALYDRAFT_478496 or related proteins could help develop crops with enhanced ability to exclude sodium ions while maintaining potassium uptake under saline conditions.

  • Heavy metal contamination resistance: Research has indicated that the Casparian strip serves as a barrier against toxic heavy metals . Manipulating ARALYDRAFT_478496 expression or function could potentially enhance this barrier function, enabling crops to grow in contaminated soils while minimizing heavy metal accumulation in edible tissues.

  • Nutrient use efficiency: Studies have shown that certain CASP genes may be involved in ion defect processes . This insight could be leveraged to develop crops with improved nutrient acquisition capabilities, particularly in low-fertility soils, reducing fertilizer requirements.

  • Pathogen resistance strategies: Since Casparian strips contribute to excluding soil-borne pathogens, engineering ARALYDRAFT_478496 to enhance barrier properties could complement existing disease resistance approaches, potentially reducing crop losses due to root diseases.

These applications highlight how fundamental research on ARALYDRAFT_478496 could translate into practical agricultural innovations, contributing to more sustainable and resilient crop production systems in the face of climate change and environmental challenges.

What interdisciplinary approaches could provide new insights into the evolutionary significance of ARALYDRAFT_478496 and related proteins?

Interdisciplinary research approaches offer unique perspectives on the evolutionary significance of ARALYDRAFT_478496:

  • Comparative genomics across diverse plant lineages: Expanding analysis beyond rice and Arabidopsis to include early land plants, gymnosperms, and diverse angiosperm lineages would reveal the evolutionary trajectory of CASP proteins and their relationship to the development of vascular plant adaptations to terrestrial environments.

  • Ecological genomics: Studying CASP gene variation in plants adapted to extreme environments (drought, salinity, metal-rich soils) could reveal how natural selection has shaped ARALYDRAFT_478496 function in response to environmental pressures, potentially identifying adaptive variants with agricultural applications.

  • Systems biology integration: Combining transcriptomics, proteomics, metabolomics, and phenomics data would provide a holistic view of how ARALYDRAFT_478496 functions within broader regulatory networks, revealing emergent properties not apparent from single-omics approaches.

  • Synthetic biology approaches: Reconstructing ancestral CASP proteins based on phylogenetic analysis and testing their functionality in model systems could provide direct experimental evidence of evolutionary trajectories and functional shifts in this protein family.

  • Computational structural biology: Applying advanced protein structure prediction algorithms (such as AlphaFold) to CASP proteins across evolutionary history could reveal how structural changes correlate with functional divergence and adaptation.

  • Cross-kingdom comparative studies: Investigating barrier formation mechanisms in diverse eukaryotes could contextualize the evolutionary innovation represented by Casparian strips and CASP proteins, potentially revealing convergent solutions to common physiological challenges.

These interdisciplinary approaches would enhance our understanding of how ARALYDRAFT_478496 and related proteins have evolved as part of plant adaptation to terrestrial environments, with implications for both fundamental evolutionary biology and applied agricultural research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.