Recombinant Arabidopsis lyrata subsp. lyrata Casparian strip membrane protein ARALYDRAFT_482586 (ARALYDRAFT_482586)

Shipped with Ice Packs
In Stock

Description

Functional Role in Plants

ARALYDRAFT_482586 is functionally analogous to Arabidopsis thaliana CASP1, which:

  • Establishes membrane diffusion barriers by restricting lateral movement of membrane proteins .

  • Directs lignin deposition by interacting with peroxidases (e.g., PER64) and respiratory burst oxidases (RBOHF) .

  • Requires regulatory kinases (SGN1/SGN3) for precise localization .

Mutational studies show that CASP proteins are essential for maintaining root endodermal integrity and nutrient homeostasis .

Research Applications

This recombinant protein is used to study:

  • Membrane domain assembly: Insights into how CASPs form stable scaffolds .

  • Lignin biosynthesis: Mechanisms of localized cell wall modification .

  • Evolution of CASPL proteins: Comparative analyses across land plants and green algae .

Comparative Analysis with CASPL Family

CASPL proteins share structural homology with animal MARVEL proteins but exhibit plant-specific adaptations:

FeatureCASPs (e.g., ARALYDRAFT_482586)MARVEL Proteins
Transmembrane spans44
FunctionMembrane scaffolding, lignin synthesisTight junction formation
ConservationLand plants and green algaeEukaryotes

CASPs likely evolved from MARVEL proteins to address plant-specific needs for apoplastic barriers .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ARALYDRAFT_482586; Casparian strip membrane protein 1; AlCASP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)
Target Names
ARALYDRAFT_482586
Target Protein Sequence
MAKESTTIDVGEPSTVTKSSSHVVKKKGFVAAAAGGGAKRGLAIFDFLLRLAAIGVTIGA ASVMYTAQETLPFFTQFLQFQAGYDDLPAFQYFVIAVAIVASYLVLSLPFSIVTIVRPLA VAPRLILLIFDTLVVTLNTSAAAAAASIVYLAHNGNQSTNWLPICQQFGDFCQNVSTAVV AASIAILFFIVLIIISAIALKRH
Uniprot No.

Target Background

Function
This protein regulates membrane-cell wall junctions and localized cell wall deposition. It is essential for establishing the Casparian strip membrane domain (CSD) and subsequently forming Casparian strips, a cell wall modification in the root endodermis. Casparian strips function as an apoplastic barrier between the internal (intraorganismal) apoplasm and the external (extraorganismal) apoplasm, preventing lateral diffusion.
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does ARALYDRAFT_482586 compare with other members of the CASP family in Arabidopsis species?

ARALYDRAFT_482586 belongs to a broader family of Casparian strip membrane proteins, which in Arabidopsis thaliana includes CASP1-CASP5. Recent comparative analysis has identified 39 AtCASP genes in Arabidopsis thaliana grouped into six distinct subgroups . The ARALYDRAFT_482586 protein in Arabidopsis lyrata shares significant sequence homology with these AtCASP proteins, particularly in the transmembrane domains.

Comparative expression analysis reveals that, like many CASP proteins, ARALYDRAFT_482586 shows predominant expression in root tissues, specifically in endodermal cells . Unlike some CASP proteins that might be expressed in other tissues, ARALYDRAFT_482586 appears to be primarily endodermis-specific, reflecting its specialized role in Casparian strip formation .

What are the optimal storage and handling conditions for recombinant ARALYDRAFT_482586?

For optimal experimental results with recombinant ARALYDRAFT_482586:

  • Store the protein at -20°C for regular usage

  • For extended storage periods, conserve at -20°C or -80°C

  • Maintain in Tris-based buffer with 50% glycerol (optimized for this specific protein)

  • Avoid repeated freezing and thawing cycles

  • For working experiments, store aliquots at 4°C for up to one week

This protocol maintains protein stability and prevents degradation that could compromise experimental results. When preparing working solutions, it's advisable to thaw the stock solution on ice and make single-use aliquots to prevent protein damage from multiple freeze-thaw cycles .

What experimental approaches are most effective for studying ARALYDRAFT_482586 localization in plant tissues?

Investigating ARALYDRAFT_482586 localization requires specialized techniques due to its membrane-embedded nature. Recommended methodological approaches include:

  • Fluorescent protein fusion constructs: Creating ARALYDRAFT_482586-GFP or ARALYDRAFT_482586-mCherry fusion proteins under native or appropriate promoters enables visualization of protein localization in living tissues. This approach has successfully demonstrated the precise localization of CASP proteins to the Casparian strip domain .

  • Immunohistochemistry: Using specific antibodies against ARALYDRAFT_482586, followed by tissue sectioning and fluorescent secondary antibody detection, allows for precise localization studies in fixed tissues.

  • Membrane fractionation: To biochemically confirm membrane localization, subcellular fractionation followed by western blotting can determine which membrane compartments contain ARALYDRAFT_482586.

  • Time-lapse imaging: For studying the dynamics of ARALYDRAFT_482586 recruitment to the Casparian strip domain, time-lapse confocal microscopy using fluorescent protein fusions has proven particularly effective. This approach revealed that CASPs are initially targeted to the whole plasma membrane, then quickly removed from lateral plasma membranes and remain localized exclusively at the CSD .

When analyzing mutant phenotypes, researchers should examine potential defects in Casparian strip formation using the propidium iodide penetration assay, which reveals functional defects in the endodermal barrier .

How can site-directed mutagenesis be used to investigate functional domains of ARALYDRAFT_482586?

Site-directed mutagenesis represents a powerful approach for structure-function analysis of ARALYDRAFT_482586. Based on research with related CASP proteins, several key strategies emerge:

  • Transmembrane domain mutations: Mutations in conserved residues within transmembrane domains can dramatically affect protein localization and function. For example, studies with AtCASP1 demonstrated that targeted mutations in these regions prevented proper localization to the Casparian strip domain .

  • Extracellular loop mutations: The extracellular loops (particularly EL1 and EL2) contain key residues for CASP protein function. Specific mutations in highly conserved residues such as C168S, F174V, G158S, and W164G in AtCASP1 resulted in impaired localization patterns . Similar mutation strategies could reveal functional domains in ARALYDRAFT_482586.

  • Deletion constructs: As demonstrated with AtCASP1, deletion of extracellular loops can help determine their necessity for proper localization. Interestingly, AtCASP1 was still able to localize correctly when either one of the extracellular loops was deleted, suggesting redundancy in their function .

  • Conserved signature regions: The CASP EL1 signature is particularly important for function. Mutations in this region would likely disrupt the protein's ability to form the Casparian strip .

Table 1: Key Residues for Potential Site-Directed Mutagenesis in ARALYDRAFT_482586

Domain TypeTarget ResiduesExpected EffectDetection Method
TransmembraneConserved hydrophobic residuesDisrupted membrane insertionLocalization assays
Extracellular Loop 1CASP signature residuesImpaired Casparian strip formationPropidium iodide penetration
Extracellular Loop 2Conserved Cys, Trp residuesDelayed/reduced CSD localizationTime-course imaging
Cytoplasmic regionsPotential interaction motifsDisrupted protein-protein interactionsCo-immunoprecipitation

What advanced imaging techniques provide optimal visualization of ARALYDRAFT_482586 in the endodermal Casparian strip?

Visualizing ARALYDRAFT_482586 within the Casparian strip requires specialized imaging approaches due to the unique structure of this domain:

  • Super-resolution microscopy: Techniques such as Structured Illumination Microscopy (SIM), Stimulated Emission Depletion (STED), or Photoactivated Localization Microscopy (PALM) overcome the diffraction limit of conventional microscopy, enabling precise localization of ARALYDRAFT_482586 within the narrow Casparian strip domain.

  • Correlative Light and Electron Microscopy (CLEM): This combined approach allows researchers to correlate the fluorescent signal of tagged ARALYDRAFT_482586 with ultrastructural features of the Casparian strip visible by electron microscopy.

  • Fluorescence Recovery After Photobleaching (FRAP): FRAP analysis has proven particularly valuable for studying the dynamics and stability of CASP proteins. Research has shown that CASPs demonstrate extremely low turnover in the membrane domain, although they are eventually removed . This technique would be valuable for comparing the membrane dynamics of ARALYDRAFT_482586 with other CASP family members.

  • Ratiometric imaging: For studying co-localization with other proteins or cellular structures, ratiometric imaging with spectrally distinct fluorophores can provide quantitative data on the spatial relationship between ARALYDRAFT_482586 and other components of the Casparian strip.

  • Lignin autofluorescence: Complementing protein localization, the lignin component of Casparian strips can be visualized through its autofluorescence, allowing correlation between ARALYDRAFT_482586 localization and functional barrier formation .

How does ARALYDRAFT_482586 contribute to endodermal barrier function in Arabidopsis lyrata?

ARALYDRAFT_482586, like other CASP proteins, plays a dual role in endodermal barrier formation:

  • Membrane scaffold formation: ARALYDRAFT_482586 contributes to the formation of a membrane scaffold that creates a diffusion barrier within the plasma membrane itself. This scaffold restricts the lateral diffusion of membrane proteins and lipids, effectively compartmentalizing the endodermal cell membrane .

  • Cell wall modification direction: By interacting with secreted peroxidases, ARALYDRAFT_482586 mediates the localized deposition of lignin in the cell wall adjacent to the membrane domain. This directed modification results in the formation of the Casparian strip, a lignin-rich cell wall region that blocks apoplastic diffusion between the soil solution and the vascular tissues .

These two functions can be experimentally uncoupled, as research has shown that:

  • Formation of the CASP membrane domain occurs independently of lignin deposition

  • Interactions between CASPs and peroxidases can take place outside the Casparian strip domain when CASPs are ectopically expressed

ARALYDRAFT_482586 is therefore a critical component in establishing selective nutrient uptake in plants by creating both a membrane diffusion barrier and directing the formation of a cell wall barrier in the endodermis.

What protein-protein interactions are critical for ARALYDRAFT_482586 function in Casparian strip formation?

Several key protein interactions are essential for ARALYDRAFT_482586 function in Casparian strip formation:

  • Homotypic CASP interactions: ARALYDRAFT_482586 likely interacts with itself and other CASP family members to form the stable protein scaffold that defines the Casparian strip domain. These interactions involve the transmembrane domains and are critical for the formation of the membrane platform .

  • Peroxidase interactions: Research on related CASP proteins has demonstrated interactions with secreted peroxidases that are essential for lignin polymerization. These peroxidases are recruited to the Casparian strip domain through direct interaction with CASP proteins .

  • NADPH oxidase interactions: RESPIRATORY BURST OXIDASE HOMOLOG F (RBOHF) produces reactive oxygen species required for lignin polymerization and interacts with the CASP protein complex.

  • MYB transcription factor regulation: Analysis of cis-elements indicates that most CASP genes contain MYB binding motifs, suggesting regulation by MYB transcription factors . This transcriptional regulation may coordinate the expression of multiple components of the Casparian strip formation machinery.

  • ESB1 (ENHANCED SUBERIN 1) interactions: While not directly demonstrated for ARALYDRAFT_482586, studies with other CASP proteins suggest potential interactions with ESB1, which is required for correct Casparian strip formation.

These interactions form a molecular complex that coordinates both the spatial definition of the Casparian strip domain and the enzymatic activities required for lignin deposition and barrier formation.

How can gene editing approaches be used to study ARALYDRAFT_482586 function in planta?

Gene editing techniques offer powerful approaches to investigate ARALYDRAFT_482586 function:

When evaluating phenotypes in edited plants, researchers should examine:

  • Casparian strip integrity using apoplastic tracer dyes

  • Ion homeostasis through ionomic profiling

  • Plant responses to environmental stresses, particularly drought and salt stress

  • Root development and architecture

  • Potential compensatory expression of other CASP family members

How is ARALYDRAFT_482586 evolutionarily related to other CASP family proteins across plant species?

Evolutionary analysis reveals important insights about ARALYDRAFT_482586's relationships within the broader CASP family:

  • Ancient evolutionary origin: CASP-like (CASPL) proteins have been found in all major divisions of land plants as well as in green algae, indicating an ancient evolutionary origin predating the emergence of vascular plants .

  • Relationship to animal proteins: Homologs of CASP proteins outside the plant kingdom have been identified as members of the MARVEL protein family, suggesting a very ancient shared ancestry and conserved function in membrane domain organization .

  • Expansion in vascular plants: Whole genome duplication (WGD) and tandem duplication (TD) events have driven the evolution and diversification of the CASP gene family, with WGDs being the dominant force. This has resulted in the expansion to 41 OsCASP genes in rice and 39 AtCASP genes in Arabidopsis thaliana .

  • Conservation of critical domains: The transmembrane domains show the highest conservation across CASP family members, while the extracellular loops, particularly EL1, contain signature sequences specific to functional CASP subgroups .

  • Correlation with Casparian strip presence: The CASP EL1 signature appears specifically in plants that form Casparian strips. It is notably absent in non-vascular plants like mosses and liverworts, which have no roots or have roots of different evolutionary origin. This signature is present in all examined roots of Casparian strip-bearing organisms .

  • Conservation in parasitic plants: Intriguingly, even in parasitic plants with modified root anatomy, such as Striga asiatica, a CASP homolog with a perfectly conserved EL1 signature has been identified, suggesting the essential nature of this protein family .

What are the key differences between ARALYDRAFT_482586 and its Arabidopsis thaliana orthologs?

Comparative analysis between ARALYDRAFT_482586 and its A. thaliana orthologs reveals several noteworthy differences:

  • Sequence divergence: While the core transmembrane domains remain highly conserved, specific sequence variations occur primarily in the loop regions and terminal domains, reflecting species-specific adaptations.

  • Expression patterns: RNA-seq analysis indicates that CASP genes show tissue-specific expression patterns, with certain orthologs demonstrating more restricted expression than others. In Arabidopsis thaliana, AtCASP_like1/31 showed pronounced expression in endodermal cells, suggesting a potentially specialized role similar to ARALYDRAFT_482586 .

  • Regulatory elements: Analysis of cis-regulatory elements shows that while MYB binding motifs are common among CASP genes, the specific arrangement and combination of regulatory elements differ between species, potentially leading to differential expression patterns and responses to environmental stimuli .

  • Functional specialization: Evidence suggests that while ARALYDRAFT_482586 and its orthologs share the core function of Casparian strip formation, they may have evolved species-specific roles in response to different environmental pressures faced by A. lyrata compared to A. thaliana.

  • Evolutionary rate: The substitution rates between orthologous pairs suggest different selective pressures acting on CASP genes in the two species, with core functional domains showing strong purifying selection.

How can phylogenetic analysis inform functional predictions about ARALYDRAFT_482586?

Phylogenetic analysis provides valuable insights for predicting ARALYDRAFT_482586 functions:

  • Functional group assignment: Placement within the broader CASP family tree helps assign ARALYDRAFT_482586 to a specific functional subgroup. The six distinct subgroups identified in recent analyses likely represent different functional specializations within the CASP family.

  • Identification of functional motifs: Comparing sequences across the phylogenetic tree reveals conserved motifs that have been maintained through evolutionary time, indicating their essential role in protein function. For ARALYDRAFT_482586, the conserved EL1 signature appears critical for Casparian strip formation .

  • Prediction of environmental responses: Closely related CASP genes in rice (OsCASP_like2/3/13/17/21/30) have been identified as candidate genes involved in ion defect processes . Based on phylogenetic proximity, ARALYDRAFT_482586 may share similar roles in responding to ion stress conditions.

  • Domain function inference: Phylogenetic analysis of specific protein domains rather than whole sequences can reveal domain-specific evolutionary patterns. For instance, the stronger conservation of transmembrane domains compared to loop regions suggests their critical role in core protein function .

  • Co-evolution patterns: Examining co-evolution patterns with interacting proteins (such as peroxidases) across species can help predict specific interaction partners for ARALYDRAFT_482586 in Arabidopsis lyrata.

A comprehensive phylogenetic framework also allows researchers to make informed choices when selecting distantly related CASP proteins for complementation studies, ensuring that functional differences observed are due to protein sequence rather than evolutionary distance.

How might ARALYDRAFT_482586 be utilized in engineering enhanced stress tolerance in crops?

ARALYDRAFT_482586 and related CASP proteins offer promising applications for crop improvement:

When evaluating engineered plants, comprehensive phenotyping should include:

  • Ionomic profiling under various stress conditions

  • Water use efficiency measurements

  • Nutrient uptake kinetics

  • Yield stability across environmental gradients

  • Potential unintended consequences on symbiotic interactions

How do contradictory findings about CASP protein functions across different studies relate to ARALYDRAFT_482586 research?

The scientific literature contains some apparent contradictions regarding CASP protein functions that must be considered when studying ARALYDRAFT_482586:

  • Functional redundancy vs. specificity: Some studies suggest high functional redundancy among CASP family members, while others indicate specific roles for individual proteins. For ARALYDRAFT_482586, this raises questions about whether its function is unique or partially redundant with other family members .

  • Primary vs. secondary functions: While the primary role of CASP proteins in Casparian strip formation is well-established, secondary functions in other biological processes have been proposed with varying levels of evidence. These include potential roles in pathogen response, hormone signaling, and development beyond the endodermis .

  • Mechanistic disagreements: Different models exist for how CASP proteins facilitate lignin deposition, with some studies emphasizing direct peroxidase recruitment and others suggesting more complex regulatory mechanisms. When studying ARALYDRAFT_482586, researchers should consider these competing models .

  • Species-specific differences: Studies in different plant species have revealed variations in CASP gene expression patterns and functions, creating apparent contradictions that may actually reflect species-specific adaptations. The comparative analysis between rice and Arabidopsis CASP genes revealed both similarities and differences in expression patterns .

  • Technical considerations: Contradictions may also arise from differences in experimental approaches, genetic backgrounds, or environmental conditions. When designing experiments with ARALYDRAFT_482586, researchers should carefully consider these methodological factors.

To address these contradictions in ARALYDRAFT_482586 research, investigators should:

  • Employ multiple complementary experimental approaches

  • Use appropriate controls, including other CASP family members

  • Carefully document experimental conditions

  • Consider evolutionary context when interpreting results

  • Directly test competing hypotheses within the same experimental system

What methodological challenges must be overcome in studying membrane-localized proteins like ARALYDRAFT_482586?

Investigating membrane-localized proteins like ARALYDRAFT_482586 presents several methodological challenges:

  • Protein extraction and purification: Membrane proteins are notoriously difficult to extract and purify in their native conformation. For ARALYDRAFT_482586, specialized detergent-based extraction protocols are required, potentially including:

    • Optimization of detergent type and concentration

    • Two-phase extraction systems

    • Nanodiscs or liposome reconstitution for functional studies

    • Membrane fractionation techniques to isolate specific membrane domains

  • Structural analysis limitations: Traditional structural biology techniques have limitations for membrane proteins. Researchers studying ARALYDRAFT_482586 should consider:

    • Cryo-electron microscopy for complex structures

    • NMR approaches optimized for membrane proteins

    • Computational modeling informed by evolutionary analysis

    • Cross-linking mass spectrometry to capture interaction interfaces

  • Localization and trafficking complexities: The dynamic localization of CASP proteins to specific membrane domains presents imaging challenges. Advanced approaches include:

    • Super-resolution microscopy techniques

    • Live-cell imaging with minimal phototoxicity

    • Correlative light and electron microscopy

    • Quantitative analysis of protein dynamics

  • Functional redundancy: The presence of multiple CASP family members complicates loss-of-function studies. Strategies to address this include:

    • Generation of higher-order mutants

    • Dominant-negative approaches

    • Chemical genetics with engineered sensitivity

    • Tissue-specific interference approaches

  • In planta protein-protein interactions: Studying the interactions of membrane proteins in their native context is challenging. Researchers investigating ARALYDRAFT_482586 should consider:

    • Split-fluorescent protein complementation optimized for membrane proteins

    • Proximity labeling techniques (BioID, APEX2)

    • Co-immunoprecipitation approaches optimized for membrane proteins

    • Single-molecule coincidence detection

These methodological challenges require interdisciplinary approaches combining molecular biology, biochemistry, advanced imaging, and computational modeling to fully characterize ARALYDRAFT_482586 function.

What are the most significant unresolved questions about ARALYDRAFT_482586 function?

Despite advances in understanding CASP proteins, several critical questions about ARALYDRAFT_482586 remain unresolved:

  • Precise molecular mechanism: How exactly does ARALYDRAFT_482586 coordinate the spatial organization of the Casparian strip domain while also recruiting the lignin polymerization machinery? The dual function as both a membrane scaffold and director of cell wall modification requires further mechanistic clarification .

  • Regulation and turnover: While CASP proteins show remarkable stability in the membrane domain, they are eventually removed . The mechanisms controlling ARALYDRAFT_482586 turnover, including potential post-translational modifications and degradation pathways, remain poorly understood.

  • Environmental responsiveness: How does ARALYDRAFT_482586 expression and function respond to environmental challenges such as nutrient deficiency, drought, or pathogen attack? The presence of MYB binding motifs suggests potential stress-responsive regulation .

  • Species-specific adaptations: What specific adaptations in ARALYDRAFT_482586 sequence or regulation have evolved in Arabidopsis lyrata compared to related species, and how do these adaptations relate to the ecological niche of this species?

  • Interaction network: The complete interaction network of ARALYDRAFT_482586, including both protein-protein interactions and potential interactions with membrane lipids and cell wall components, requires further elucidation.

  • Functional redundancy boundaries: The precise degree of functional overlap between ARALYDRAFT_482586 and other CASP family members remains to be determined, including whether there are unique functions that cannot be complemented by other family members.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.