Recombinant Arabidopsis lyrata subsp. lyrata Casparian strip membrane protein ARALYDRAFT_488377 (ARALYDRAFT_488377)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
ARALYDRAFT_488377; Casparian strip membrane protein 5; AlCASP5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)
Target Names
ARALYDRAFT_488377
Target Protein Sequence
MKSGQAEIVETSKGIQKSGLMSRRIAILEFILRIVAFFNTIGSAILMGTTHETLPFFTQF IRFQAEYNDLPALTFFVVANAVVSGYLIMSLTLAFVHIVKRKTQNTRILLIVLDVAMLGL LSAGASSAAAIVYLAHNGNNKTNWFAICQQFNSFCERISGSLIGSFIAVVLLILLILLSA IALSRRH
Uniprot No.

Target Background

Function
This protein regulates membrane-cell wall junctions and localized cell wall deposition. It is essential for establishing the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips. These strips are cell wall modifications in the root endodermis that act as an apoplastic barrier, preventing lateral diffusion between the intraorganismal and extraorganismal apoplasm. This barrier is crucial for the plant's uptake of water and nutrients.
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ARALYDRAFT_488377 and what is its role in plant physiology?

ARALYDRAFT_488377 is a Casparian Strip Membrane Domain Protein (CASP) in Arabidopsis lyrata subsp. lyrata. It belongs to the CASP gene family, which is pivotal for the formation of Casparian strips (CS) in endodermal cells. These proteins play crucial roles in a plant's response to environmental stresses by facilitating the development of barriers that control nutrient and water acquisition .

Methodologically, to understand its physiological role, researchers should:

  • Conduct gene knockout experiments using CRISPR/Cas9

  • Perform phenotypic analysis focusing on root development and response to abiotic stresses

  • Analyze mineral nutrient homeostasis in wildtype vs. mutant plants

  • Examine endodermal permeability using fluorescent tracers like propidium iodide (PI)

What is the structural composition of ARALYDRAFT_488377?

ARALYDRAFT_488377 is a four-membrane-span protein with a full length of 187 amino acids . Like other CASPs, it likely forms a transmembrane scaffold that mediates the deposition of Casparian strips in the endodermis by recruiting the lignin polymerization machinery .

To analyze its structure, researchers should:

  • Perform hydropathy plot analysis to confirm transmembrane domains

  • Use recombinant expression systems with His-tags for protein purification

  • Apply circular dichroism spectroscopy to determine secondary structure

  • Consider X-ray crystallography or cryo-EM for detailed 3D structure (though membrane proteins present challenges)

How does ARALYDRAFT_488377 from A. lyrata compare to its orthologues in A. thaliana?

The CASP gene family has been extensively studied in A. thaliana and A. lyrata, with 39 AtCASP genes identified in A. thaliana and 41 OsCASP genes in rice . A. lyrata, with a larger genome (207-Mb compared to A. thaliana's 125-Mb), diverged from A. thaliana approximately 10 million years ago .

For comparative analysis, researchers should:

  • Perform sequence alignment of ARALYDRAFT_488377 with A. thaliana orthologues

  • Compare expression patterns in endodermal cells between species

  • Analyze conservation of functional domains, particularly extracellular loops

  • Examine selective pressure on different regions using dN/dS ratios

What evolutionary mechanisms shaped the CASP gene family in Arabidopsis species?

Collinearity analysis has underscored the pivotal roles of Whole Genome Duplication (WGD) and Tandem Duplication (TD) events in driving the evolution of CASPs, with WGDs being the dominant force . The first extracellular loop of CASPs was found to be conserved in euphyllophytes but absent in plants lacking Casparian strips, suggesting an important connection to Casparian strip and root evolution .

For evolutionary research, consider:

  • Conducting phylogenetic analysis incorporating CASPs from multiple plant lineages

  • Mapping syntenic regions to identify duplication events

  • Analyzing selection signatures across different CASP domains

  • Performing ancestral sequence reconstruction to infer the evolutionary trajectory

What is the tissue-specific expression pattern of ARALYDRAFT_488377?

RNA-seq data reveals that most CASP genes, including likely orthologues of ARALYDRAFT_488377, are highly expressed in roots, particularly in endodermal cells . In A. thaliana, CASPL proteins show specific expression in a variety of cell types, such as trichomes, abscission zone cells, peripheral root cap cells, and xylem pole pericycle cells .

To study expression patterns:

  • Utilize quantitative RT-PCR with tissue-specific sampling

  • Develop promoter-reporter constructs (e.g., pARALYDRAFT_488377::GFP)

  • Perform in situ hybridization for precise cellular localization

  • Use single-cell RNA-seq to identify cell-specific expression profiles

How is ARALYDRAFT_488377 expression regulated at the transcriptional level?

Analysis of cis-elements indicates that most CASP genes contain MYB binding motifs . The MYB36 transcription factor controls the expression of most genes associated with CS formation . The network of transcriptional factors involving SHR, SCR, and MYB36 controls endodermal differentiation .

For transcriptional regulation studies:

  • Perform chromatin immunoprecipitation (ChIP) with MYB36 antibodies

  • Use yeast one-hybrid assays to identify transcription factors binding to the promoter

  • Create promoter deletion constructs to identify essential regulatory elements

  • Analyze expression changes in myb36, shr, and scr mutant backgrounds

What experimental approaches can determine ARALYDRAFT_488377's role in Casparian strip formation?

To determine the protein's role in CS formation:

  • Generate knockout/knockdown lines using CRISPR/Cas9 or RNAi

  • Assess CS integrity using lignin-specific stains like Basic Fuchsin

  • Evaluate barrier function using apoplastic tracers like propidium iodide

  • Perform complementation assays with fluorescently tagged proteins

  • Use super-resolution microscopy to analyze CS structure in mutants

Based on similar studies with other CASPs, researchers should look for:

  • Disrupted lignin deposition in the CS

  • Increased endodermal permeability

  • Loss of mineral nutrient homeostasis

  • Potential compensatory mechanisms like enhanced suberin deposition

What protein interaction partners have been identified for CASP proteins similar to ARALYDRAFT_488377?

While specific interaction partners for ARALYDRAFT_488377 are not directly mentioned in the search results, studies of related CASPs indicate they interact with:

  • Lignin polymerization machinery components (e.g., peroxidases like PER64)

  • Dirigent-like proteins (e.g., ESB1)

  • Receptor-like kinases involved in CS integrity sensing (e.g., SGN3)

  • NADPH oxidases for ROS production (e.g., RBOHF)

To identify interaction partners:

  • Perform co-immunoprecipitation with tagged ARALYDRAFT_488377

  • Use yeast two-hybrid screening

  • Conduct proximity labeling techniques (BioID or APEX)

  • Analyze protein co-localization using fluorescently tagged proteins

What is the subcellular localization pattern of ARALYDRAFT_488377 and how does it relate to function?

Based on studies of similar CASPs, ARALYDRAFT_488377 likely localizes to the plasma membrane at the Casparian strip membrane domain. CASPs form highly scaffolded transmembrane domains that guide where the CS forms .

To study subcellular localization:

  • Generate fluorescently tagged constructs (e.g., ARALYDRAFT_488377-GFP)

  • Use confocal microscopy for live-cell imaging

  • Perform immunogold labeling for electron microscopy

  • Track protein dynamics using photobleaching techniques (FRAP)

The localization may follow the pattern observed in other CASPs, where:

  • Initial accumulation occurs at the periphery of endodermal cells

  • Localization shifts to the Casparian strip membrane domain

  • Protein forms stable scaffolds within specialized membrane domains

How do membrane nanodomains form during Casparian strip development and what role might ARALYDRAFT_488377 play?

Studies of CASP proteins reveal that the CS consists of distinct nanodomains where different proteins localize preferentially. For example, some CASPs accumulate more at the periphery while others concentrate in the central region .

To investigate nanodomains:

  • Use super-resolution microscopy techniques (STORM, SIM, STED)

  • Perform co-localization studies with known nanodomain markers

  • Analyze protein diffusion rates using single-particle tracking

  • Conduct lipid composition analysis of isolated membrane domains

ARALYDRAFT_488377 might function similarly to other CASPs in organizing membrane nanodomains that facilitate the precise deposition of lignin approximately 2 μm wide and 150 nm thick spanning the apoplastic space between adjacent endodermal cells .

How can recombinant ARALYDRAFT_488377 be efficiently expressed and purified for structural studies?

According to available product information, recombinant full-length ARALYDRAFT_488377 can be expressed in E. coli with a His-tag . For optimal expression and purification:

  • Expression optimization:

    • Test different E. coli strains (BL21(DE3), Rosetta, C41/C43)

    • Optimize induction conditions (temperature, IPTG concentration)

    • Consider fusion tags beyond His (MBP, GST) to improve solubility

    • Use specialized vectors for membrane protein expression

  • Purification protocol:

    • Solubilize membrane fractions with appropriate detergents (DDM, LMNG)

    • Use immobilized metal affinity chromatography (IMAC)

    • Perform size exclusion chromatography for final purity

    • Consider amphipol exchange for improved stability

  • Quality assessment:

    • Verify purity by SDS-PAGE and Western blotting

    • Confirm proper folding using circular dichroism

    • Assess homogeneity by dynamic light scattering

What advanced imaging techniques are most suitable for studying ARALYDRAFT_488377 localization and dynamics in vivo?

Based on studies with other CASP proteins, the following advanced imaging approaches are recommended:

  • Super-resolution microscopy:

    • Structured Illumination Microscopy (SIM) has been successfully used to visualize CS nanodomains

    • Stochastic Optical Reconstruction Microscopy (STORM) for nanometer-scale resolution

    • Stimulated Emission Depletion (STED) microscopy for live-cell super-resolution

  • Dynamic analysis:

    • Fluorescence Recovery After Photobleaching (FRAP) to measure protein mobility

    • Fluorescence Lifetime Imaging Microscopy (FLIM) to detect protein interactions

    • Single-particle tracking for nanodomain organization studies

  • Multi-dimensional analysis:

    • Correlative Light and Electron Microscopy (CLEM) to connect protein localization with ultrastructure

    • Light-sheet microscopy for 3D time-lapse imaging with reduced phototoxicity

    • Multi-color imaging to track multiple components simultaneously

How does ARALYDRAFT_488377 function contribute to plant stress responses?

CASPs like ARALYDRAFT_488377 are crucial for forming the Casparian strip, which controls the acquisition of nutrients and water necessary for normal plant development and stress responses . RT-qPCR results in rice suggest that some CASP genes may be specifically involved in ion defect processes .

To study stress response functions:

  • Expose wildtype and ARALYDRAFT_488377 mutant plants to various stresses:

    • Nutrient deficiency (N, P, K, Fe)

    • Salt stress

    • Drought conditions

    • Heavy metal exposure

  • Monitor gene expression changes under stress using qRT-PCR

  • Analyze physiological parameters (growth, ion content, water relations)

  • Perform comparative transcriptomics to identify stress-responsive pathways affected by mutation

What is the relationship between ARALYDRAFT_488377 function and mineral nutrient homeostasis?

The Casparian strip, which requires proper CASP function, plays a critical role in controlling mineral nutrient homeostasis . Defects in CS formation can lead to altered nutrient uptake and distribution.

For nutrient homeostasis studies:

  • Use inductively coupled plasma mass spectrometry (ICP-MS) to analyze elemental profiles

  • Perform radiotracer studies to track nutrient uptake and translocation

  • Analyze expression of nutrient transporters in wildtype vs. mutant backgrounds

  • Study the effect of varying nutrient conditions on CS integrity

How does ARALYDRAFT_488377 compare with other members of the CASP and CASPL families?

CASPs and CASP-like (CASPL) proteins form a large family found in all major divisions of land plants and green algae . When ectopically expressed in the endodermis, most CASPLs can integrate into the CASP membrane domain, suggesting a shared propensity to form transmembrane scaffolds .

For comparative analysis:

  • Perform phylogenetic analysis of CASP and CASPL families

  • Compare domain architecture and conserved motifs

  • Analyze tissue-specific expression patterns across family members

  • Test functional complementation between different family members

Family ClassificationDistributionMembrane IntegrationKey Characteristics
CASP (core proteins)Endodermis-specificForms CS membrane domain scaffoldFour-membrane span, essential for CS formation
CASPLMultiple cell typesCan integrate into CASP domain when ectopically expressedSimilar structure, diverse functions
MARVEL (non-plant homologs)Found outside plant kingdomMembrane associationEvolutionary relationship to CASPs

What functional redundancy exists between ARALYDRAFT_488377 and related proteins?

Studies on similar CASP proteins indicate potential functional redundancy, as often multiple family members must be mutated to observe severe phenotypes . For example, casp1casp3 double mutants show more severe defects than single mutants .

To investigate functional redundancy:

  • Generate single and higher-order mutant combinations

  • Perform complementation assays with different family members

  • Analyze expression compensation in single mutants

  • Compare protein localization patterns among family members

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.