Recombinant Arabidopsis lyrata subsp. lyrata Casparian strip membrane protein ARALYDRAFT_660474 (ARALYDRAFT_660474)

Shipped with Ice Packs
In Stock

Description

Functional Role in Plant Physiology

ARALYDRAFT_660474 belongs to the CASP (Casparian Strip Membrane Domain Protein) gene family, which is essential for:

  • CS Formation: Mediates plasma membrane domain organization and lignin polymerization in endodermal cells .

  • Ion Selectivity: Regulates nutrient uptake and solute transport by forming apoplastic barriers .

  • Stress Response: Linked to abiotic stress tolerance, as CASP genes are highly expressed under environmental challenges .

Phylogenetic analysis groups AtCASP genes (including ARALYDRAFT_660474) into six subfamilies, with whole-genome duplication (WGD) and tandem duplication (TD) driving evolutionary diversification .

Expression Patterns and Research Insights

RNA-seq data reveal that AtCASP genes, including ARALYDRAFT_660474, exhibit:

  • Tissue-Specific Expression: Strongest in roots, particularly endodermal cells .

  • Stress-Responsive Activity: Upregulated under ionic stress, suggesting roles in ion homeostasis .

Gene AttributeDetail
Gene SynonymsCasparian strip membrane protein 4; AlCASP4
UniProt IDD7LZ50
Cis-Regulatory ElementsMYB-binding motifs, indicative of transcriptional regulation

Applications in Biomedical and Plant Research

Recombinant ARALYDRAFT_660474 is utilized in:

  • Protein Interaction Studies: Investigating CASP-peroxidase interactions critical for lignin deposition .

  • Structural Biology: Elucidating transmembrane domain assembly mechanisms .

  • Stress Biology: Modeling abiotic stress responses in Arabidopsis and related species .

Research Gaps and Future Directions

While ARALYDRAFT_660474’s role in CS formation is well-documented, unresolved questions include:

  • Mechanistic Details: How extracellular loops coordinate with peroxidases for lignin polymerization .

  • Evolutionary Conservation: Functional comparison with homologs in green algae and non-plant MARVEL proteins .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ARALYDRAFT_660474; Casparian strip membrane protein 4; AlCASP4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)
Target Names
ARALYDRAFT_660474
Target Protein Sequence
MKSDSIAVDVPAESSSAIKGKAPLLGLARDHTGSGGYKRGLSIFDFLLRLAAIVAALAAA ATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVVAIAIVTGYLVLSLPFSVVTIVRPLAV APRLLLLVLDTAALALDTAAASAAAAIVYLAHNGNTNTNWLPICQQFGDFCQKTSGAVVS AFASVTFLAILVVISGVSLKRP
Uniprot No.

Target Background

Function
This protein regulates membrane-cell wall junctions and localized cell wall deposition. It is essential for establishing the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips. These strips are modifications of the root endodermis cell wall that create an apoplastic barrier between the internal (intraorganismal) apoplasm and the external (extraorganismal) apoplasm, preventing lateral diffusion.
Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Arabidopsis lyrata CASP4 protein and its function in plants?

Arabidopsis lyrata CASP4 (ARALYDRAFT_660474) is a Casparian strip membrane domain protein that plays an essential role in the formation of Casparian strips in plant roots. The Casparian strip is an impregnation of endodermal cell wall that creates an apoplastic diffusion barrier, forcing symplastic and selective transport of nutrients across the endodermis . This structure is found in the roots of all higher plants and provides protection to vascular tissues .

In functional terms, CASP proteins like ARALYDRAFT_660474 localize specifically at the Casparian strip formation site, where they guide local lignin deposition . These transmembrane proteins help establish a local scaffold to assemble a set of enzymes including Respiratory Burst Oxidase Homolog F (RBOHF), Peroxidase 64 (PER64), and Enhanced Suberin 1 (ESB1), which are necessary for the lignification process and proper Casparian strip formation .

How does ARALYDRAFT_660474 compare to other CASP proteins in the Arabidopsis family?

ARALYDRAFT_660474 (AlCASP4) from Arabidopsis lyrata is homologous to CASP proteins in Arabidopsis thaliana and other plant species. Phylogenetic analysis indicates that CASP proteins form a distinct family with conserved functions across plant species . In Arabidopsis thaliana, CASP1 and CASP3 play particularly vital roles during Casparian strip formation .

The functional conservation of the Casparian strip regulatory cascade has been observed between Arabidopsis thaliana and other species with more complex root systems, suggesting that ARALYDRAFT_660474 maintains similar core functions as its homologs . The protein belongs to a membrane-localized family that has evolved specifically to support the specialized structure of the Casparian strip.

While specific comparisons of binding affinities and interaction strengths between AlCASP4 and other CASP proteins have not been explicitly provided in the search results, the phylogenetic relationships shown in Figure 2 of search result demonstrate the evolutionary relationships between CASP-related genes across different plant species.

What are the optimal storage and reconstitution conditions for recombinant ARALYDRAFT_660474?

For optimal storage and reconstitution of recombinant ARALYDRAFT_660474 protein, follow these methodological guidelines:

Storage Conditions:

  • Store the lyophilized powder at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration between 5-50% (recommended default is 50%)

  • Aliquot for long-term storage at -20°C/-80°C

The protein is supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . Repeated freezing and thawing significantly reduces protein activity and should be avoided to maintain functional integrity for experimental applications.

How should researchers design experiments to study ARALYDRAFT_660474 function in Casparian strip formation?

When designing experiments to study ARALYDRAFT_660474 function in Casparian strip formation, researchers should follow this systematic approach:

Step 1: Define Variables

  • Independent variable: ARALYDRAFT_660474 expression or activity levels

  • Dependent variable: Casparian strip integrity, formation, or function

  • Control variables: Growth conditions, developmental stage, genetic background

Step 2: Hypothesis Development
Formulate specific, testable hypotheses about ARALYDRAFT_660474's role in Casparian strip formation. For example: "Knockdown of ARALYDRAFT_660474 will disrupt the localized deposition of lignin in the Casparian strip."

Step 3: Experimental Treatments
Design treatments to manipulate ARALYDRAFT_660474 expression:

  • Gene knockout/knockdown using CRISPR-Cas9 or RNAi

  • Overexpression using constitutive or inducible promoters

  • Site-directed mutagenesis to analyze specific protein domains

  • Protein localization studies using fluorescent tags

Step 4: Subject Assignment

  • Use between-subjects design comparing wild-type, mutant, and rescued plants

  • Or within-subjects design comparing different regions of the same root

Step 5: Measurement Methods

  • Visualize Casparian strips using lignin-specific dyes (e.g., basic fuchsin)

  • Assess barrier function using tracer uptake experiments

  • Analyze protein localization using immunofluorescence or GFP fusion proteins

  • Evaluate plant performance under stress conditions to assess physiological consequences

A robust experimental design should include appropriate controls and sufficient replication to ensure statistical validity, with careful consideration of developmental timing since Casparian strip formation is developmentally regulated.

What techniques are most effective for visualizing ARALYDRAFT_660474 localization in plant roots?

For effective visualization of ARALYDRAFT_660474 localization in plant roots, researchers should consider these methodological approaches:

Fluorescent Protein Fusion Techniques:

  • Generate transgenic plants expressing ARALYDRAFT_660474-GFP (or other fluorescent protein) fusion proteins under native promoters

  • Use confocal laser scanning microscopy for high-resolution imaging of protein localization

  • Combine with counterstains for cell walls (propidium iodide) or plasma membrane (FM4-64) for contextual reference

Immunolocalization Methods:

  • Develop antibodies specific to ARALYDRAFT_660474

  • Perform immunohistochemistry on fixed root sections

  • Use fluorescently labeled secondary antibodies for detection

  • Apply tissue clearing techniques to enhance visualization depth

Co-localization Studies:

  • Perform dual labeling with known Casparian strip markers

  • Use markers for cell wall components (lignin, suberin) to correlate protein localization with Casparian strip formation

  • Implement FRET or BiFC techniques to study protein-protein interactions with other components of the Casparian strip machinery

Live Imaging Approaches:

  • Employ spinning disk confocal microscopy for dynamic studies of protein localization during development

  • Use light-sheet microscopy for long-term, low-phototoxicity imaging of developing roots

  • Apply inducible expression systems to track newly synthesized protein movement

These visualization techniques should be complemented with appropriate controls to verify specificity and rule out artifacts, especially when using fluorescent protein fusions that might affect protein function or localization.

How do CASP proteins interact with other components of the Casparian strip regulatory network?

CASP proteins engage in a complex interaction network with multiple molecular components to regulate Casparian strip formation. These interactions include:

Scaffold Function:
CASP proteins, including ARALYDRAFT_660474, serve as a localized scaffold that recruits and assembles enzymes required for lignin polymerization. Specifically, they interact with:

  • RBOHF (Respiratory Burst Oxidase Homolog F): Produces reactive oxygen species needed for lignin polymerization

  • PER64 (Peroxidase 64): Catalyzes the oxidative coupling of monolignols

  • ESB1 (Enhanced Suberin 1): Contributes to the integrity of the Casparian strip

Regulation by Receptor-Like Kinases:
The precise localization of CASP proteins is controlled by two receptor-like kinases:

  • SGN1 (SCHENGEN1): Functions in positional regulation

  • SGN3 (SCHENGEN3): Works combinatorially with SGN1 to ensure proper Casparian strip formation
    Both mutants display defects in Casparian strip integrity, indicating their essential role in CASP protein function

Peptide Hormone Signaling:

  • CIF1/2 (Casparian strip integrity factors): These stele-derived small peptides move to the endodermis via the apoplastic pathway

  • CIFs bind directly to SGN3 to promote intact Casparian strip formation

  • This interaction represents a critical signaling pathway for endodermal barrier function

Transcriptional Regulation:

  • MYB36: Acts as a master regulator activating the expression of CASP1, ESB1, and PER64

  • SCR (SCARECROW): Controls MYB36 expression

  • SHR (SHORT-ROOT): Expresses in stele and moves to endodermal cells via the symplastic pathway, activating SCR

This intricate regulatory network ensures the spatiotemporal precision of Casparian strip formation, with CASP proteins serving as key structural organizers at the plasma membrane-cell wall interface.

What are the challenges in expressing and purifying functional ARALYDRAFT_660474 for in vitro studies?

Researchers face several challenges when expressing and purifying functional ARALYDRAFT_660474 for in vitro studies:

Membrane Protein Solubility Issues:

  • ARALYDRAFT_660474 is a transmembrane protein that naturally localizes to the plasma membrane

  • The hydrophobic domains can cause aggregation during expression and purification

  • Selecting appropriate detergents or lipid nanodisc systems is crucial for maintaining native conformation

Expression System Limitations:

  • Current recombinant production relies on E. coli expression systems

  • Bacterial expression may lack plant-specific post-translational modifications

  • Codon optimization for bacterial expression can be necessary for efficient production

  • Alternative expression in plant-based systems might better preserve native function but typically yields lower protein amounts

Protein Stability Concerns:

  • The protein requires specific buffer conditions (Tris/PBS-based buffer with 6% Trehalose, pH 8.0)

  • Repeated freeze-thaw cycles significantly reduce activity

  • Working aliquots have limited stability (up to one week at 4°C)

Functional Verification Challenges:

  • In vitro assays may not replicate the complex in vivo environment of the Casparian strip

  • The protein normally functions within a multiprotein complex including RBOHF, PER64, and ESB1

  • Reconstituting functional complexes in vitro requires co-expression or co-purification strategies

Structural Characterization Difficulties:

  • The transmembrane nature of the protein complicates structural studies

  • Traditional crystallization methods may be ineffective

  • Cryo-EM or NMR approaches may be more suitable but present their own technical challenges

To address these challenges, researchers might need to use specialized approaches such as fusion tags that enhance solubility, mild detergents that preserve native structure, and careful optimization of expression conditions to balance protein yield with functional integrity.

How do environmental stresses affect CASP protein function and Casparian strip formation?

Environmental stresses significantly impact CASP protein function and Casparian strip formation, with important implications for plant adaptation and survival:

Nutrient Stress Responses:

  • Mineral deficiencies or toxicities alter Casparian strip development to regulate nutrient uptake

  • SGN3 mutants (which affect CASP localization) show disrupted magnesium and potassium homeostasis

  • Casparian strip modifications serve as an adaptive response to maintain optimal nutrient balance

Water Stress Adaptation:

  • Drought conditions typically enhance Casparian strip formation to reduce water loss

  • The integrity of CASP-dependent barriers becomes particularly important during water limitation

  • Modified Casparian strip development represents a key adaptation to water stress

Salt Stress Responses:

  • Salinity stress induces changes in Casparian strip formation to limit sodium uptake

  • CASP proteins may show altered expression patterns under high salinity

  • The apoplastic barrier function becomes critical for excluding toxic ions

Temperature Stress Effects:

  • Temperature extremes can disrupt the proper assembly of CASP proteins

  • The lignification process mediated by CASP-recruited enzymes may be temperature-sensitive

  • Thermal stress can alter the timing and extent of Casparian strip formation

Oxidative Stress Interactions:

  • ROS (Reactive Oxygen Species) are essential for lignin polymerization in Casparian strips

  • RBOHF, which interacts with CASP proteins, is a key ROS producer

  • Environmental stresses that alter ROS homeostasis may directly impact CASP function and Casparian strip integrity

The complex regulatory network controlling CASP protein function allows plants to modify their root barrier properties in response to environmental challenges, highlighting the importance of these proteins for stress adaptation and survival.

How can ARALYDRAFT_660474 research contribute to improving crop stress resistance?

Research on ARALYDRAFT_660474 and related CASP proteins offers several pathways to improving crop stress resistance:

Enhanced Nutrient Use Efficiency:

  • Optimizing Casparian strip formation could improve selective nutrient uptake

  • Crops with modified CASP expression might better exclude toxic elements while efficiently absorbing beneficial minerals

  • This could reduce fertilizer requirements and enable cultivation on marginal soils with nutrient imbalances

Improved Drought Tolerance:

  • CASP-mediated modifications to the root endodermal barrier could enhance water retention

  • Strategic manipulation of Casparian strip development might allow crops to maintain water balance under drought conditions

  • Targeted expression of optimized CASP variants could create more drought-resilient root systems

Salt Tolerance Enhancement:

  • Engineering CASP proteins to strengthen the apoplastic barrier could improve salt exclusion

  • Crops with modified Casparian strips might grow more successfully in saline soils

  • This application could expand arable land to regions affected by soil salinization

Heavy Metal Exclusion:

  • Strengthened Casparian strips could better prevent heavy metal uptake

  • Crops grown in contaminated soils might accumulate fewer toxins

  • This could improve food safety and allow cultivation on remediated industrial lands

Climate Resilience:

  • Understanding how environmental factors influence CASP function could help develop crops adapted to climate change

  • Temperature-optimized CASP variants might maintain barrier function under extreme conditions

  • This knowledge could contribute to breeding programs focused on climate resilience

These applied research directions require translating fundamental knowledge about ARALYDRAFT_660474 and the Casparian strip regulatory network from model plants to crop species, with careful consideration of the more complex root systems found in many crops compared to Arabidopsis .

What are the evolutionary implications of CASP protein conservation across plant species?

The evolutionary conservation of CASP proteins across plant species reveals important insights about plant adaptation and development:

Fundamental Root Barrier Function:

  • The presence of CASP homologs across diverse plant lineages indicates the essential nature of Casparian strips

  • This conservation suggests that the selective barrier function provided by CASPs was an early adaptation in vascular plant evolution

  • The maintenance of this system across evolutionary time underscores its fundamental importance for plant survival

Functional Conservation Amid Structural Diversity:

  • Phylogenetic analysis shows that while CASP protein sequences may vary, their function remains conserved

  • This suggests strong selective pressure to maintain Casparian strip formation despite divergent evolution in other traits

  • The spatiotemporal expression pattern of essential CS components is conserved even in plants with complex root systems

Regulatory Network Evolution:

  • The conservation extends beyond CASP proteins to include regulatory elements like MYB36, SHR, and SGN3

  • This indicates the co-evolution of an entire genetic module rather than isolated proteins

  • Figure 2 in search result illustrates the phylogenetic relationships of these components across species

Adaptation to Ecological Niches:

  • Subtle variations in CASP proteins may reflect adaptations to different environmental conditions

  • Species from water-limited environments might show modifications in CASP function to enhance water retention

  • Aquatic or semi-aquatic species may have evolved different CASP regulatory mechanisms

Implications for Plant Diversification:

  • The ability to regulate nutrient and water uptake through CASP-dependent barriers likely facilitated plant adaptation to diverse habitats

  • This evolutionary innovation may have contributed to the radiation of vascular plants into various ecological niches

  • Understanding CASP evolution provides insights into the mechanisms of plant adaptation throughout evolutionary history

The conservation of CASP proteins and their regulatory network across different plant species with varying root complexity suggests that this mechanism emerged early in plant evolution and has been maintained due to its essential role in plant survival and adaptation.

What methodological advances are needed to better study CASP protein interactions in vivo?

Several methodological advances would significantly enhance our ability to study CASP protein interactions in living plant systems:

Advanced Imaging Techniques:

  • Super-resolution microscopy beyond the diffraction limit to visualize CASP protein organization at nanometer scale

  • Adaptive optics to improve imaging depth in intact root tissues

  • Correlative light and electron microscopy (CLEM) to connect protein localization with ultrastructural features

  • Four-dimensional imaging (3D + time) with reduced phototoxicity to track dynamic CASP interactions during development

Protein Interaction Technologies:

  • Improved split fluorescent protein systems with reduced artifacts for studying protein-protein interactions

  • Proximity labeling techniques (BioID, APEX) adapted for plant systems to identify transient interaction partners

  • Single-molecule tracking to analyze CASP mobility and clustering in the plasma membrane

  • Optogenetic tools to manipulate CASP interactions with temporal and spatial precision

Genetic Engineering Advances:

  • CRISPR-Cas9 base editing for precise modification of endogenous CASP genes

  • Tissue-specific and inducible gene expression systems with minimal leakiness

  • Multiplexed genome editing to simultaneously modify multiple components of the CASP regulatory network

  • Synthetic biology approaches to reconstitute minimal functional CASP systems

Biochemical Methods:

  • Improved membrane protein extraction techniques that preserve protein-protein interactions

  • Native mass spectrometry adapted for membrane protein complexes

  • Hydrogen-deuterium exchange mass spectrometry for probing structural dynamics

  • Cryo-electron tomography of intact cellular specimens to visualize CASP complexes in their native environment

Computational Approaches:

  • Machine learning algorithms for automated identification of Casparian strip features in microscopy data

  • Molecular dynamics simulations of CASP proteins in lipid bilayers

  • Systems biology models integrating transcriptomic, proteomic, and metabolomic data

  • Network analysis tools to map the complete CASP interactome

These methodological advances would collectively enable researchers to move beyond static snapshots of CASP function to understand the dynamic assembly, regulation, and adaptation of Casparian strip formation in living plants under various environmental conditions.

What are the common pitfalls in CASP protein expression studies and how can they be avoided?

Researchers working with CASP proteins frequently encounter several challenges that can be mitigated with appropriate strategies:

ChallengeCauseSolution
Poor protein solubilityHydrophobic transmembrane domainsUse specialized detergents (DDM, LMNG); Consider fusion with solubility-enhancing tags (MBP, SUMO); Express truncated versions lacking some transmembrane regions
Low expression levelsCodon bias; Protein toxicity to expression hostOptimize codons for expression system; Use tightly controlled inducible promoters; Lower induction temperature (16-20°C)
Protein aggregationImproper folding; Inappropriate buffer conditionsInclude chaperone co-expression; Optimize buffer pH and ionic strength; Add stabilizing agents like trehalose (6%)
Loss of activity during purificationHarsh purification conditions; Detergent effectsUse mild purification conditions; Test different detergents or nanodiscs; Minimize time between extraction and assay
Freeze-thaw degradationIce crystal formation; Protein denaturationAdd cryoprotectants (glycerol 5-50%); Aliquot single-use volumes; Avoid repeated freeze-thaw cycles
Inconsistent experimental resultsVariable protein quality; Incomplete reconstitutionImplement rigorous quality control; Standardize expression and purification protocols; Include positive controls in each experiment

Additionally, researchers should validate protein functionality after expression and purification using activity assays or binding studies specific to CASP proteins, as structural integrity does not always guarantee functional activity.

How can researchers address data inconsistencies when studying Casparian strip formation across different plant species?

When studying Casparian strip formation across different plant species, researchers may encounter data inconsistencies that require systematic approaches to resolve:

Standardize Developmental Staging:

  • Create normalized developmental timelines based on anatomical landmarks rather than chronological age

  • Define precise positional references (e.g., distance from root tip, cell number from initials)

  • Document and report growth conditions in detail to facilitate cross-laboratory comparisons

Harmonize Visualization Methods:

  • Establish standardized staining protocols optimized for each species

  • Develop quantitative metrics for Casparian strip integrity and completeness

  • Use multiple complementary techniques (fluorescence, electron microscopy) to verify observations

Control for Root Structural Differences:

  • Account for variation in root anatomy between species (number of cell layers, endodermal features)

  • Consider root type differences (primary vs. lateral roots)

  • Acknowledge that Arabidopsis has a simpler root structure than many crop species

Address Genetic Variation:

  • Use multiple accessions or cultivars to distinguish species-specific from genotype-specific traits

  • When possible, conduct comparative studies using transgenic approaches with identical constructs

  • Consider evolutionary distance when comparing CASP functions across distant species

Implement Robust Statistical Approaches:

  • Increase biological replication to account for higher variability in non-model species

  • Apply appropriate statistical tests for non-normally distributed data

  • Use mixed-effect models to account for nested experimental designs

Integrate Multi-omics Data:

  • Combine transcriptomic, proteomic, and metabolomic approaches to build comprehensive models

  • Use network analysis to identify conserved and divergent regulatory modules

  • Validate key findings with targeted functional studies across species

What quality control measures are essential when working with recombinant ARALYDRAFT_660474 protein?

Purity Assessment:

  • Perform SDS-PAGE analysis to verify protein purity (should exceed 90%)

  • Consider size-exclusion chromatography to detect aggregates or oligomeric states

  • Use mass spectrometry to confirm protein identity and detect potential modifications

Functional Verification:

  • Develop binding assays to confirm interaction with known partners (RBOHF, PER64, ESB1)

  • Assess membrane integration capability in artificial lipid systems

  • Verify correct folding using circular dichroism or other spectroscopic methods

Storage Stability Monitoring:

  • Implement regular quality checks during long-term storage

  • Establish activity benchmarks to detect functional degradation over time

  • Document freeze-thaw cycles and storage conditions for each protein batch

Batch Consistency Validation:

  • Maintain detailed records of expression and purification parameters

  • Compare new batches against reference standards

  • Implement consistent reconstitution protocols to minimize variation

Contaminant Testing:

  • Check for endotoxin contamination when using E. coli expression systems

  • Verify removal of affinity tags if they were cleaved during purification

  • Test for protease activity that could degrade the protein during experiments

Structural Integrity Assessment:

  • Consider limited proteolysis to verify protein folding

  • Use thermal shift assays to assess protein stability

  • Employ native PAGE to examine quaternary structure

A comprehensive quality control workflow should include documentation at each step, with acceptance criteria defined before experiments begin. For critical experiments, researchers should consider using protein from multiple independent preparations to ensure that observed effects are not batch-specific artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.