Recombinant Arabidopsis thaliana 1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplastic (LPAT1)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
LPAT1; ATS2; EMB1995; LPAAT1; At4g30580; F17I23.80; 1-acyl-sn-glycerol-3-phosphate acyltransferase LPAT1, chloroplastic; Lysophosphatidyl acyltransferase 1; Protein EMBRYO DEFECTIVE 1995
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
57-356
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
LPAT1
Target Protein Sequence
SEKFMGETRRTGIQWSNRSLRHDPYRFLDKKSPRSSQLARDITVRADLSGAATPDSSFPE
PEIKLSSRLRGIFFCVVAGISATFLIVLMIIGHPFVLLFDPYRRKFHHFIAKLWASISIY
PFYKINIEGLENLPSSDTPAVYVSNHQSFLDIYTLLSLGKSFKFISKTGIFVIPIIGWAM
SMMGVVPLKRMDPRSQVDCLKRCMELLKKGASVFFFPEGTRSKDGRLGSFKKGAFTVAAK
TGVAVVPITLMGTGKIMPTGSEGILNHGNVRVIIHKPIHGSKADVLCNEARSKIAESMDL
Uniprot No.
Target Background
Function
A plastidial enzyme in the prokaryotic glycerol-3-phosphate pathway, this protein converts lysophosphatidic acid (LPA) to phosphatidic acid by incorporating an acyl moiety at the sn-2 position. It utilizes palmitoyl-ACP (16:0-ACP) to produce phosphatidic acid with a saturated group at the sn-2 position, a characteristic of lipids synthesized via the prokaryotic pathway. In vitro, it can also utilize 16:0-CoA as an acyl donor. This enzyme is crucial for embryo development during the transition from the globular to heart stage, coinciding with chloroplast formation.
Gene References Into Functions
- Lysophosphatidic acid acyltransferase (LPAT) plays a role in phosphatidic acid synthesis, a key intermediate in glycerolipid biosynthesis. [LPAT1] PMID: 20488893
Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed. Expressed at higher level in leaves. Expressed at lower level in silique walls compared to leaves.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
