Recombinant Arabidopsis thaliana 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 (LPAT2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
LPAT2; LPAAT2; At3g57650; F15B8.160; 1-acyl-sn-glycerol-3-phosphate acyltransferase 2; Lysophosphatidyl acyltransferase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
LPAT2
Target Protein Sequence
MVIAAAVIVPLGLLFFISGLAVNLFQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWIV DWWAGVKIQVFADNETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKS SKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRLSDFPRPFWLALFVEGTRFTEAKL KAAQEYAASSELPIPRNVLIPRTKGFVSAVSNMRSFVPAIYDMTVTIPKTSPPPTMLRLF KGQPSVVHVHIKCHSMKDLPESDDAIAQWCRDQFVAKDALLDKHIAADTFPGQQEQNIGR PIKSLAVVLSWACVLTLGAIKFLHWAQLFSSWKGITISALGLGIITLCMQILIRSSQSER STPAKVVPAKPKDNHHPESSSQTETEKEK
Uniprot No.

Target Background

Function

This recombinant Arabidopsis thaliana 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 (LPAT2) converts lysophosphatidic acid (LPA) to phosphatidic acid by acyl moiety incorporation at the sn-2 position. It exhibits a preference for C-18-CoA substrates over C-16-CoA substrates and is essential for female, but not male, gametophyte development.

Gene References Into Functions
  1. A revised model of membrane lipid remodeling is proposed, highlighting the significant contribution of LPAT2-mediated de novo phospholipid biosynthesis to root development under phosphate starvation. PMID: 28548242
  2. AtLPAT2 encodes a ubiquitous, abundant, ER-located LPAT essential for female gametophyte development. PMID: 15772283
Database Links

KEGG: ath:AT3G57650

STRING: 3702.AT3G57650.1

UniGene: At.34815

Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Present in roots, leaves, stems, floral buds and siliques (at protein level). Widely expressed. In contrast to LPAT1, it is not expressed at higher level in leaves.

Q&A

What is Arabidopsis thaliana LPAT2 and what is its biological significance?

Arabidopsis thaliana LPAT2 (1-acyl-sn-glycerol-3-phosphate acyltransferase 2) is a pivotal enzyme controlling the metabolic flow of lysophosphatidic acid into different phosphatidic acids in diverse tissues. It functions in the second acylation step of membrane and storage lipid biosynthesis, catalyzing the transfer of an acyl group from acyl-CoA to the sn-2 position of lysophosphatidic acid to form phosphatidic acid. LPAT2 is encoded by the At3g57650 gene (also known as F15B8.160) and is ubiquitously expressed throughout the plant, making it essential for normal growth and development .

How does LPAT2 differ structurally and functionally from other LPAT family members?

PropertyLPAT2LPAT3LPAT4LPAT5
Primary expression patternUbiquitousPredominantly pollenLow in all tissuesLow in all tissues
Subcellular localizationEndoplasmic reticulumNot specifiedNot specifiedNot specified
E. coli mutant complementationYesNot fullyNot detectedNot detected
Unique featuresC-terminal sequenceHigher expression in pollenDifferent intron patternDifferent intron pattern

LPAT2 is distinguished by having a unique C-terminal sequence absent in other LPATs, which can be used to generate specific antibodies . Both LPAT2 and LPAT3 share similar positions of transmembrane segments along their sequences, which differs from the pattern shared by LPAT4 and LPAT5 .

What is the subcellular localization of LPAT2 and how has it been determined?

LPAT2 is primarily localized in the endoplasmic reticulum (ER). This localization has been confirmed through multiple experimental approaches:

  • Immunofluorescence microscopy demonstrating colocalization with calreticulin (an ER marker)

  • Subcellular fractionation studies

  • Studies in tapetum cells of Arabidopsis and Brassica, where the ER is abundant and interfering autofluorescent chloroplasts are absent

The colocalization studies revealed that LPAT2 is largely present in the same ER regions as calreticulin, though some small ER subdomains showed differential occupation, reaffirming the presence of specialized subdomains within the ER .

What are the optimal conditions for handling recombinant LPAT2 protein in laboratory settings?

For researchers working with recombinant LPAT2, the following handling conditions are recommended:

ParameterRecommended Condition
Storage temperature-20°C to -80°C
Short-term storage4°C for up to one week
FormLyophilized powder
Reconstitution bufferDeionized sterile water
Recommended concentration0.1-1.0 mg/mL
Storage additive5-50% glycerol (50% recommended)
Special handlingCentrifuge vial before opening; aliquot for multiple use; avoid repeated freeze-thaw cycles
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0

These conditions are designed to maintain protein stability and enzymatic activity for experimental applications .

How can LPAT2 enzymatic activity be effectively assayed in laboratory settings?

Researchers can assess LPAT2 enzymatic activity through both in vivo complementation and in vitro biochemical assays:

  • Functional Complementation Assay:

    • Transform Escherichia coli JC201 (temperature-sensitive LPAT mutant) with LPAT2 expression vector

    • The mutant normally grows at 30°C but not at 42°C

    • Successful complementation (growth at 42°C) indicates functional LPAT activity

    • Note: Excessive expression of LPAT2 may inhibit bacterial growth, so expression conditions require optimization

  • In Vitro Enzyme Activity Assay:

    • Express recombinant LPAT2 in bacteria or yeast

    • Prepare membrane fractions or purify the protein

    • Measure acyltransferase activity using radiolabeled or fluorescently-labeled substrates

    • Compare activity with different acyl-CoA donors (18:1-CoA vs. 16:0-CoA)

  • Substrate Specificity Analysis:

    • Perform competition assays with different acyl-CoA species

    • Analyze reaction products using chromatographic techniques to determine incorporation rates

What strategies are effective for generating and detecting LPAT2-specific antibodies?

Generating and using LPAT2-specific antibodies involves several strategic considerations:

  • Epitope Selection:

    • Target the unique C-terminal sequence of LPAT2 (absent in LPAT3-5 and all other Arabidopsis proteins)

    • This approach ensures specificity for LPAT2 without cross-reactivity with other LPAT family members

  • Antibody Production:

    • Synthesize peptide corresponding to the C-terminal sequence

    • Conjugate to carrier protein and immunize animals

    • Purify antibodies through affinity chromatography

  • Validation Methods:

    • Verify specificity against recombinant LPAT2, LPAT3, LPAT4, and LPAT5 expressed in yeast

    • Confirm by Western blotting that antibodies react with LPAT2 but not with other family members

    • Test cross-reactivity with LPAT2 orthologs from related species (antibodies recognize BnLPAT2 in Brassica napus)

  • Applications:

    • Western blotting detects LPAT2 as a single band in various Arabidopsis tissues

    • Immunofluorescence microscopy for subcellular localization studies

    • Co-immunoprecipitation to identify interacting proteins

What genetic approaches can be used to study LPAT2 function in Arabidopsis?

Several genetic approaches have proven valuable for studying LPAT2 function:

  • T-DNA Insertional Mutagenesis:

    • Identify null allele (lpat2) with T-DNA insertion in the LPAT2 gene

    • Analyze heterozygous mutants (LPAT2/lpat2) for phenotypic alterations

    • The heterozygous mutant shows minimal vegetative changes but produces shorter siliques with normal seeds and aborted ovules in a 1:1 ratio

  • Complementation Studies:

    • Transform heterozygous mutants with LPAT2-cDNA driven by the LPAT2 promoter

    • Successful complementation produces viable lpat2/lpat2 homozygous plants

    • Alternatively, express LPAT3-cDNA under the LPAT2 promoter to test functional redundancy

    • LPAT3 can rescue female gametophyte lethality but cannot support full embryo maturation

  • Genetic Crossing Experiments:

    • Cross heterozygous mutants with wild-type plants

    • Analyze segregation patterns to determine gametophytic effects

    • Results indicate that lpat2 causes lethality in female gametophytes but not male gametophytes (which express LPAT3)

  • Promoter-Reporter Gene Fusions:

    • Use LPAT2 promoter driving β-glucuronidase to study expression patterns

    • Confirms ubiquitous expression in diverse tissues

What phenotypes are associated with LPAT2 deficiency in Arabidopsis?

LPAT2 deficiency leads to distinctive phenotypes with particular impact on reproduction:

GenotypeVegetative PhenotypeReproductive PhenotypeFemale GametophyteMale Gametophyte
LPAT2/LPAT2 (WT)NormalNormal siliques with viable seedsViableViable
LPAT2/lpat2 (heterozygous)Minimal alterationShorter siliques with 1:1 ratio of normal to aborted seeds50% lethalViable
lpat2/lpat2 (homozygous)Not observed naturally (lethal)Not observed naturally (lethal)LethalViable

The heterozygous mutant (LPAT2/lpat2) shows minimal altered vegetative phenotype but produces shorter siliques containing normal seeds and aborted ovules in a 1:1 ratio. This indicates that the lpat2 allele causes lethality in female gametophytes. In contrast, male gametophytes can survive with the lpat2 mutation due to the redundant function of LPAT3, which is highly expressed in pollen .

How does LPAT2 contribute to female gametophyte development?

LPAT2 plays a critical and non-redundant role in female gametophyte development:

  • The lpat2 mutation causes complete female gametophyte lethality, indicating that LPAT2 is essential for female gametophyte viability .

  • The absence of LPAT2 in female gametophytes cannot be compensated by other LPAT family members, suggesting that:

    • Other LPAT family members are not sufficiently expressed in female gametophytes

    • LPAT2 may have specialized functions in the female gametophyte that other LPATs cannot fulfill

    • The precise lipid composition provided by LPAT2 activity may be critical for female gametophyte development

  • Complementation studies reveal that LPAT3-cDNA driven by the LPAT2 promoter can rescue the lpat2 female gametophytes to allow fertilization but not full embryo maturation, suggesting partial functional redundancy .

What functional redundancy exists between LPAT2 and LPAT3 in reproductive tissues?

LPAT2 and LPAT3 exhibit tissue-specific functional redundancy in reproductive development:

How can researchers differentiate between LPAT2 and other members of the LPAT family?

Differentiating between LPAT family members requires multiple complementary approaches:

  • Sequence-Based Differentiation:

    • Phylogenetic analysis reveals two distinct groups: LPAT2/LPAT3 and LPAT4/LPAT5

    • LPAT2 contains a unique C-terminal sequence absent in other family members

    • Intron patterns differ between the two groups, with LPAT2/LPAT3 sharing a pattern distinct from LPAT4/LPAT5

  • Expression Pattern Analysis:

    • LPAT2 is expressed ubiquitously across tissues

    • LPAT3 is expressed predominantly in pollen

    • LPAT4 and LPAT5 are expressed at low levels across tissues

    • RT-PCR, microarray, or RNA-seq can distinguish expression patterns

  • Protein Detection Methods:

    • Use antibodies raised against the unique C-terminal sequence of LPAT2

    • These antibodies specifically detect LPAT2 without cross-reacting with LPAT3-5

    • Western blotting shows LPAT2 as a single band in various Arabidopsis tissues

  • Functional Assays:

    • LPAT2 and LPAT3 show detectable LPAT activity when expressed in bacteria or yeast

    • LPAT4 and LPAT5 do not show activity above endogenous levels in these expression systems

    • Complementation of E. coli JC201 mutant: LPAT2 successfully complements the mutant

What are the most challenging aspects of working with recombinant LPAT2 protein?

Working with recombinant LPAT2 presents several technical challenges:

  • Expression Toxicity:

    • Expression of LPAT2 in bacteria strongly inhibits growth, even at low inducer concentrations (0.2 mM IPTG)

    • This toxicity is common when expressing eukaryotic membrane proteins in bacterial systems

    • Requires careful optimization of expression conditions to balance protein yield and host viability

  • Membrane Protein Purification:

    • As an integral membrane protein, LPAT2 requires detergents for extraction and purification

    • Maintaining proper folding and activity during purification is challenging

    • The protein may require specific lipid environments to maintain native conformation

  • Enzymatic Activity Preservation:

    • Recombinant LPAT2 may lose activity during purification or storage

    • Requires careful handling to maintain function: avoid repeated freeze-thaw cycles

    • Storage as aliquots with glycerol (5-50%) at -20°C/-80°C is recommended

  • Functional Assays:

    • Enzymatic assays require appropriate substrates and detection methods

    • Background activity from host enzymes must be controlled for

    • Quantitative activity measurements require optimized conditions and careful controls

What are the current frontiers in LPAT2 research?

Current and emerging areas in LPAT2 research include:

  • Detailed Structure-Function Analysis:

    • Determining the three-dimensional structure of LPAT2

    • Identifying critical residues for substrate binding and catalysis

    • Understanding how LPAT2 interacts with membrane lipids and partner proteins

  • Regulatory Mechanisms:

    • Investigating post-translational modifications that regulate LPAT2 activity

    • Understanding how LPAT2 expression and activity are regulated during development

    • Exploring how environmental stresses affect LPAT2 function

  • Metabolic Engineering Applications:

    • Modifying LPAT2 to alter membrane lipid composition

    • Engineering LPAT2 substrate specificity to produce novel lipids

    • Using LPAT2 in synthetic biology approaches to modify plant lipid profiles

  • Comparative Studies Across Species:

    • Analyzing LPAT2 orthologs across plant species to understand evolutionary conservation

    • Identifying species-specific adaptations in LPAT function

    • Applying insights from model systems to improve crops

How can researchers address common challenges in LPAT2 protein expression systems?

Researchers frequently encounter challenges when expressing LPAT2 in various systems. Here are methodological solutions:

  • For E. coli Expression Systems:

    • Use lower inducer concentrations (0.2 mM IPTG or less) to reduce toxicity

    • Consider specialized E. coli strains designed for membrane protein expression

    • Use lower growth temperatures (16-25°C) to slow expression and improve folding

    • Consider fusion tags that enhance solubility or membrane integration

    • Use tightly controlled inducible promoters to minimize leaky expression

  • For Yeast Expression Systems:

    • Select appropriate yeast strains with reduced protease activity

    • Optimize codon usage for yeast expression

    • Use inducible promoters with fine-tuned expression levels

    • Consider secretory pathway modifications to improve membrane protein trafficking

  • For Plant Expression Systems:

    • Use native promoters or tissue-specific promoters to control expression levels

    • Consider transient expression systems for rapid analysis

    • For stable transformation, select appropriate selectable markers and screening methods

    • Use fluorescent protein fusions to monitor localization and expression levels

What strategies can overcome difficulties in detecting LPAT enzymatic activity?

Detection of LPAT enzymatic activity can be challenging. These methodological approaches can help:

  • Substrate Preparation and Handling:

    • Ensure lysophosphatidic acid substrates are fresh and properly solubilized

    • Prepare acyl-CoA donors immediately before use to prevent hydrolysis

    • Consider using stabilized or fluorescent-labeled substrates for improved detection

  • Assay Optimization:

    • Test multiple buffer conditions (pH 6.0-8.0) and salt concentrations

    • Optimize detergent type and concentration for membrane protein activity

    • Include appropriate cofactors that may enhance activity (Mg²⁺, Mn²⁺)

    • Vary temperature conditions (25-37°C) to find optimal activity

  • Detection Methods:

    • Use radioisotope-labeled substrates (¹⁴C or ³H) for highest sensitivity

    • Consider fluorescent or biotin-labeled substrates for non-radioactive detection

    • Employ HPLC, TLC, or MS methods to separate and quantify reaction products

    • Use coupled enzyme assays to amplify signals for detection

What considerations are important when analyzing LPAT2 mutant phenotypes?

Proper analysis of LPAT2 mutant phenotypes requires careful methodological approaches:

  • Genetic Background Controls:

    • Always compare mutants to appropriate wild-type controls in the same genetic background

    • For heterozygous analysis, use siblings from the same seed batch when possible

    • Consider generating multiple independent mutant lines to confirm phenotypes

  • Gametophytic Lethality Analysis:

    • Examine segregation ratios carefully (expect 1:1 in heterozygotes with female gametophyte lethality)

    • Perform reciprocal crosses to distinguish between male and female effects

    • Use confocal microscopy with appropriate staining to directly observe developing gametophytes

  • Complementation Controls:

    • Use the native promoter when possible for complementation studies

    • Confirm transgene expression levels in complemented lines

    • Generate multiple independent transgenic lines to control for position effects

    • For partial complementation (as with LPAT3 driven by LPAT2 promoter), carefully document the extent of rescue

  • Tissue-Specific Effects:

    • Examine multiple tissues and developmental stages

    • Consider using tissue-specific promoters to generate conditional knockouts

    • Employ cell-type-specific markers to identify affected cell populations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.