Recombinant Arabidopsis thaliana 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 (LPAT3)

Shipped with Ice Packs
In Stock

Description

Biological Function and Enzymatic Activity

LPAT3 is a cytoplasmic lysophosphatidyl acyltransferase (LPAT) with tissue-specific roles:

Key Functions

  • Lipid Biosynthesis: Converts LPA to PA using acyl-CoA substrates (e.g., 18:1-CoA > 16:0-CoA) .

  • Male Gametophyte Development: Expressed predominantly in pollen, compensating for LPAT2 in male gametophytes .

  • Subcellular Localization: LPAT2 (ubiquitous ER-localized) vs. LPAT3 (pollen-enriched, possibly ER-associated) .

Substrate Specificity

SubstrateActivityReference
18:1-CoAHigher activity
16:0-CoALower activity

LPAT2 vs. LPAT3: Functional Redundancy and Specialization

FeatureLPAT2LPAT3
Tissue ExpressionUbiquitous (all sporophytic tissues)Predominant in pollen
Female Gametophyte RoleEssential for viability Insufficient for full embryo development
Enzyme ActivityComplements bacterial LPAT defectsPartially rescues LPAT2 mutants in ovules
LocalizationER (colocalizes with calreticulin)Likely ER-associated

Key Findings:

  • LPAT2 Knockout (lpat2): Causes female gametophyte lethality but not male, due to LPAT3 redundancy in pollen .

  • LPAT3 Complementation: Transgenic LPAT2P:LPAT3 partially rescues lpat2 ovules, enabling fertilization but failing embryo maturation .

  • Species-Specific Roles: In Brassica napus, LPAT3 ortholog (BAT1.3) is embryo-expressed, contrasting with Arabidopsis .

Experimental Tools

  • Recombinant LPAT3: Used to study acyltransferase activity in vitro (bacterial/yeast systems) .

  • Gene Knockouts: lpat2 mutants reveal LPAT2’s essential role in female gametophyte development .

Challenges

  • Functional Redundancy: LPAT3 cannot fully replace LPAT2 in all contexts (e.g., embryo maturation) .

  • Gene Duplication: LPAT4/5 (putative homologs) lack detectable activity, suggesting non-functionalization .

Comparative Genomics

GeneSpeciesExpression PatternRole
LPAT3ArabidopsisPollen-enriched Male gametophyte viability
BAT1.3Brassica napusEmbryo mid-stage Seed lipid synthesis
LPAT1ArabidopsisPlastid-specific Embryo development

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you require a specific format, please indicate your preference when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
LPAT3; LPAAT3; At1g51260; F11M15.12; 1-acyl-sn-glycerol-3-phosphate acyltransferase 3; Lysophosphatidyl acyltransferase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-376
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
LPAT3
Target Protein Sequence
MKIPAALVFIPVGVLFLISGLIVNIIQLVFFIIVRPFSRSLYRRINKNVAELLWLQLIWL FDWWACIKINLYVDAETLELIGKEHALVLSNHRSDIDWLIGWVMAQRVGCLGSSLAIMKK EAKYLPIIGWSMWFSDYIFLERSWAKDENTLKAGFKRLEDFPMTFWLALFVEGTRFTQEK LEAAQEYASIRSLPSPRNVLIPRTKGFVSAVSEIRSFVPAIYDCTLTVHNNQPTPTLLRM FSGQSSEINLQMRRHKMSELPETDDGIAQWCQDLFITKDAQLEKYFTKDVFSDLEVHQIN RPIKPLIVVIIWLGFLVFGGFKLLQWLSIVASWKIILLFVFFLVIATITMQILIQSSESQ RSTPAKRPLQEQLISA
Uniprot No.

Target Background

Function
Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the 2 position. Shows a preference for C-18-CoA substrates compared to C-16-CoA substrates.
Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in pollen.

Q&A

What is LPAT3 and what is its function in Arabidopsis thaliana?

LPAT3 (1-acyl-sn-glycerol-3-phosphate acyltransferase 3) is one of five LPAT isoforms found in Arabidopsis thaliana. It belongs to a family of enzymes that catalyze the acylation of lysophosphatidic acid (LPA) to form phosphatidic acid (PA), representing a critical step in the de novo glycerolipid biosynthesis pathway. This reaction involves the transfer of an acyl chain from acyl-CoA to the sn-2 position of LPA, creating PA, which serves as a precursor for both membrane phospholipids and storage lipids such as triacylglycerols (TAGs) .

How does LPAT3 relate to other members of the LPAT family?

Arabidopsis thaliana contains five genes encoding LPAT-like proteins, each with distinct subcellular localizations and physiological functions . Based on sequence homology and experimental evidence:

  • LPAT1 (LPAAT1) is localized in the plastid and is essential for embryo development, as homozygous knockout mutants are embryo-lethal

  • LPAT2 is predominantly expressed in developing seeds and contributes to TAG accumulation

  • LPAT3 belongs to the ER-localized LPAT subfamily

  • LPAT4 and LPAT5 function redundantly in the ER, contributing to membrane phospholipid and TAG biosynthesis, particularly under nitrogen starvation conditions

What expression systems and methods are optimal for producing recombinant LPAT3?

For successful expression and purification of functional recombinant Arabidopsis LPAT3, the following methodology has proven effective:

Expression System: E. coli is the preferred expression system for LPAT3, as it allows for high-yield production of the recombinant protein . BL21(DE3) or Rosetta strains are typically used due to their reduced protease activity and enhanced expression of eukaryotic proteins.

Expression Construct: Full-length LPAT3 (376 amino acids) with an N-terminal His-tag facilitates subsequent purification while maintaining enzymatic activity . The construct should include:

  • The complete coding sequence (CDS) of At1g51260

  • An optimal N-terminal His-tag (6x-His) for purification

  • A suitable vector with strong, inducible promoter (e.g., pET series)

Expression Protocol:

  • Transform the expression construct into competent E. coli cells

  • Culture transformants in LB medium with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8

  • Induce protein expression with IPTG (0.5-1.0 mM)

  • Lower incubation temperature to 16-20°C for 16-20 hours to enhance protein folding

  • Harvest cells by centrifugation and proceed with protein purification

Purification Method:

  • Resuspend cell pellet in lysis buffer containing 20-50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 1 mM PMSF, and appropriate protease inhibitors

  • Disrupt cells by sonication or French press

  • Clarify lysate by centrifugation (15,000 × g, 30 min, 4°C)

  • Purify His-tagged LPAT3 using Ni-NTA affinity chromatography

  • Elute with imidazole gradient (50-300 mM)

  • Further purify by size exclusion chromatography if necessary

  • Store purified protein in buffer containing 6% trehalose at -80°C or lyophilize for long-term storage

What are the optimal storage and reconstitution conditions for recombinant LPAT3?

Proper storage and reconstitution are critical for maintaining LPAT3 enzyme activity:

Storage Conditions:

  • Store lyophilized protein at -20°C/-80°C

  • For working aliquots, store at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles which can significantly reduce enzyme activity

Reconstitution Protocol:

  • Briefly centrifuge the vial containing lyophilized protein before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%) for long-term storage at -80°C

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

Buffer Recommendations:

  • Optimal buffer: Tris/PBS-based buffer, pH 8.0, containing 6% trehalose

  • For enzyme activity assays, include cofactors such as Mg²⁺ (1-5 mM)

How can recombinant LPAT3 be used to study substrate specificity and enzymatic mechanisms?

Understanding LPAT3 substrate specificity provides insights into its physiological role and potential biotechnological applications. The following methodologies are recommended:

In Vitro Acyltransferase Assay:

  • Prepare reaction mixture containing:

    • Purified recombinant LPAT3 (1-5 μg)

    • LPA substrate (50-100 μM)

    • Various acyl-CoA donors (16:0-CoA, 18:1-CoA, etc.) at 50 μM

    • Buffer (50 mM HEPES, pH 7.4, 5 mM MgCl₂)

  • Incubate at 30°C for 30 minutes

  • Terminate reaction with chloroform:methanol (2:1, v/v)

  • Extract lipids and analyze by TLC or LC-MS/MS

  • Quantify PA formation to determine substrate preference

Based on studies with related LPATs, differential substrate preferences may be observed. For instance, plastid LPAT1 shows significantly higher activity with 16:0-CoA compared to 18:1-CoA when using 18:1-LPA as a substrate . Similar comparative analyses with LPAT3 would reveal its unique substrate specificity profile.

Kinetic Analysis:

  • Perform acyltransferase assays with varying concentrations of substrates

  • Determine Km and Vmax for different acyl-CoA species

  • Calculate catalytic efficiency (kcat/Km) to identify preferred substrates

Site-Directed Mutagenesis:

  • Identify conserved motifs in LPAT3 sequence (e.g., acyltransferase motifs I-IV)

  • Generate point mutations in catalytic residues

  • Express and purify mutant proteins

  • Compare enzymatic activities to identify critical residues for substrate binding and catalysis

What methods can be employed to study LPAT3 function in planta?

To understand the physiological role of LPAT3 in Arabidopsis, several complementary approaches can be used:

T-DNA Insertion Mutant Analysis:

  • Obtain LPAT3 T-DNA insertion lines from seed stock centers

  • Confirm homozygosity and gene disruption by PCR and RT-PCR

  • Analyze phenotypes under various conditions (normal, nitrogen starvation, etc.)

  • Quantify glycerolipid content using lipidomic approaches

Complementary approaches with higher-order mutants: Since functional redundancy may exist among LPAT isoforms, generating double or triple mutants may be necessary to observe clear phenotypes. For example, lpat4-1 lpat5-1 double mutants show reduced phospholipid and TAG content and exacerbated growth defects under nitrogen starvation, whereas single mutants display minimal phenotypic changes .

RNA Interference (RNAi) or CRISPR-Cas9 Gene Editing:

  • Design constructs targeting LPAT3-specific sequences

  • Transform Arabidopsis with appropriate vectors

  • Confirm gene silencing/editing by RT-PCR or sequencing

  • Analyze lipid profiles and developmental phenotypes

Subcellular Localization:

  • Generate LPAT3-GFP fusion constructs

  • Express in Arabidopsis or transient expression systems

  • Visualize localization using confocal microscopy

  • Confirm by co-localization with organelle-specific markers

Complementation Studies:

  • Clone LPAT3 cDNA under a constitutive (35S) or native promoter

  • Transform into lpat3 mutant background

  • Assess restoration of wild-type phenotype and lipid profiles

How does LPAT3 function in the context of nitrogen starvation response?

Nitrogen starvation triggers significant metabolic reprogramming in plants, including increased TAG accumulation. While LPAT4 and LPAT5 have been implicated in the nitrogen starvation response, the specific role of LPAT3 remains to be fully elucidated .

Research Approaches:

  • Compare expression profiles of all LPAT isoforms under nitrogen starvation using qRT-PCR or RNA-seq

  • Analyze lpat3 mutant phenotypes and lipid profiles under normal and nitrogen-limited conditions

  • Conduct comparative lipidomics to identify specific lipid species affected by LPAT3 deficiency

  • Investigate potential regulatory mechanisms (transcriptional, post-translational) affecting LPAT3 under stress

Expected Outcomes:
Based on findings with LPAT4 and LPAT5, LPAT3 may contribute to maintaining membrane integrity and/or TAG accumulation under stress conditions. The lpat4-1 lpat5-1 double mutant shows reduced TAG and phospholipid content under normal conditions and exhibits severe growth defects under nitrogen starvation . Similar analyses with lpat3 mutants would clarify its specific contribution to stress adaptation.

What is the relationship between LPAT3 and TAG biosynthesis pathway components?

Understanding how LPAT3 interacts with other enzymes in the glycerolipid biosynthesis pathway can provide insights into metabolic regulation and potential biotechnological applications:

Comparative Analysis with DGAT1:
The phenotype of lpat4-1 lpat5-1 double mutants resembles that of dgat1-4 mutants, which affect a major TAG biosynthesis pathway . Similar comparative studies with lpat3 mutants and TAG biosynthesis mutants would reveal potential functional relationships.

Metabolic Flux Analysis:

  • Conduct pulse-chase experiments with labeled acetate or glycerol in wild-type and lpat3 mutant plants

  • Track incorporation into different lipid classes over time

  • Quantify flux through the Kennedy pathway versus alternative routes

Enzyme Complex Analysis:

  • Perform co-immunoprecipitation with tagged LPAT3

  • Identify interacting proteins by mass spectrometry

  • Validate interactions with co-localization and in vitro binding assays

Hypothetical Enzymatic Network:

EnzymeSubcellular LocalizationSubstrate PreferenceFunction in TAG Synthesis
LPAT1Plastid16:0-CoA > 18:1-CoAProvides PA for plastid membrane lipids
LPAT2ER18:1-CoA, 18:2-CoAPrimary LPAT for seed TAG biosynthesis
LPAT3ERTo be determinedPotential role in vegetative TAG synthesis
LPAT4ERMultiple acyl-CoAsContributes to membrane and TAG synthesis
LPAT5ERMultiple acyl-CoAsRedundant with LPAT4, important for N starvation response

What strategies can overcome low activity of recombinant LPAT3?

Membrane-associated enzymes like LPATs often present challenges in maintaining activity during recombinant expression and purification:

Optimization Strategies:

  • Expression temperature: Lower to 16-18°C during induction to improve protein folding

  • Detergent selection: Test multiple detergents (DDM, CHAPS, Triton X-100) at various concentrations to find optimal solubilization conditions

  • Lipid supplementation: Add phospholipids (PC, PE) to purification buffers to stabilize enzyme structure

  • Protein tags: Compare N-terminal vs. C-terminal tags to determine impact on activity

  • Codon optimization: Optimize codons for E. coli expression to improve translation efficiency

Activity Preservation:

  • Include glycerol (10-20%) in all buffers to stabilize protein structure

  • Add reducing agents (DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

  • Minimize metal ion contamination that may inhibit activity using EDTA in initial purification steps

  • Consider purification without detergent removal for assaying membrane-associated enzymatic activity

How can apparent contradictions in LPAT3 functional data be reconciled?

When discrepancies appear in experimental results regarding LPAT3 function, consider the following factors:

Methodological Considerations:

  • Protein expression systems: Results from E. coli-expressed LPAT3 may differ from yeast or insect cell expressions due to differences in post-translational modifications and protein folding

  • Assay conditions: pH, temperature, ion concentrations, and substrate presentations significantly affect enzyme activity

  • Substrate availability: Natural vs. synthetic substrates may yield different activity profiles

Biological Factors:

  • Functional redundancy: Other LPAT isoforms may compensate for LPAT3 deficiency in certain tissues or conditions

  • Developmental stage: LPAT3 function may vary across developmental stages

  • Environmental conditions: Stress factors may alter LPAT expression and activity patterns

Experimental Design for Resolution:

  • Conduct parallel experiments comparing multiple LPAT isoforms under identical conditions

  • Use complementary in vitro and in vivo approaches to validate findings

  • Perform time-course and dose-response analyses to capture the dynamic nature of lipid metabolism

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.