Recombinant Arabidopsis thaliana 15-cis-zeta-carotene isomerase, chloroplastic (Z-ISO)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Z-ISO; At1g10830; T16B5.3; 15-cis-zeta-carotene isomerase, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
59-367
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
Z-ISO
Target Protein Sequence
STLREDQPIASDSESSPTLLIGEDSAAFELGKQKLVSWVYFGVVLGVVLFILNVVWIDNS TGFGKSFIDAVSNISGSPEVAMLMLILIFAIVHSGLASLRDIGEKLIGERAFRVLFAGIS LPLAMSTIVYFINHRYDGSQLWQLQGVPGVHEAIWVANFVSFFFLYPSTFNLLEVAAVDK PKMHLWETGIMRITRHPQMVGQIVWCLAHTLWIGNTVAASASLGLIAHHLFGAWNGDRRL AKRYGEDFESIKKRTSVIPFAAIFEGRQVLPEDYYKEFVRLPYLAITALTVGAYFAHPLM QGASFRLHW
Uniprot No.

Target Background

Function

Recombinant Arabidopsis thaliana 15-cis-zeta-carotene isomerase (Z-ISO) is a chloroplast-localized isomerase crucial for carotenoid biosynthesis. Its primary function is the isomerization of the 15-cis bond in 9,15,9'-tri-cis-zeta-carotene to its trans configuration.

Gene References Into Functions
  1. Z-ISO, a chloroplast-localized protein, plays a vital role in carotenoid biosynthesis. PMID: 20335404
  2. The gene At1g10830.1 encodes 15-cis-zeta-carotene isomerase (Z-ISO), a key enzyme in plant carotenoid biosynthesis. The shorter transcript variant, At1g10830.2, lacks enzymatic activity. PMID: 20335404
Database Links

KEGG: ath:AT1G10830

STRING: 3702.AT1G10830.1

UniGene: At.17014

Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in leaves and at lower levels in roots.

Q&A

What is the basic function of Z-ISO in carotenoid biosynthesis?

Z-ISO (15-cis-zeta-carotene isomerase, chloroplastic) catalyzes the cis-to-trans conversion of the 15-cis bond in 9,15,9′-tri-cis-ζ-carotene to form 9,9′-di-cis-ζ-carotene during the multi-step conversion of phytoene to lycopene in the carotenoid biosynthetic pathway . This isomerization step is crucial for the subsequent action of zeta-carotene desaturase (ZDS), which requires the specific geometrical isomer as its substrate . In plants, the conversion from 15-cis-phytoene to all-trans-lycopene involves multiple enzymes including phytoene desaturase (PDS), Z-ISO, ZDS, and carotene isomerase (CRTISO), contrasting with bacterial systems that employ only a single enzyme (CRTI) .

What is the predicted structure of Z-ISO protein?

Z-ISO is predicted to be an integral membrane protein with five membrane-spanning domains . The protein is chloroplast-localized, as verified through large-scale proteomics and GFP fusion experiments . Computational analysis predicts a transit peptide cleavage site at residue 58 for Arabidopsis Z-ISO and residue 46 for maize Z-ISO . Recent studies using AlphaFold models of Z-ISO from Synechocystis, Zea mays, and Arabidopsis thaliana have identified putative protein ligands for the heme B cofactor and the substrate-binding site, providing insights into the structural basis of Z-ISO function despite the absence of a crystallographic structure .

How was Z-ISO initially identified and characterized?

Z-ISO was first characterized through studies of the maize (Zea mays) pale yellow9 (y9) locus . Researchers observed that recessive y9 alleles caused accumulation of 9,15,9′-tri-cis-ζ-carotene in dark tissues such as roots and etiolated leaves, contrasting with the accumulation of 9,9′-di-cis-ζ-carotene in a ZDS mutant (viviparous9) . This phenotypic analysis revealed that the Y9 gene encodes a factor required for isomerase activity upstream of CRTISO, which was subsequently termed Z-ISO . The identification of Z-ISO demonstrated that the conversion of phytoene to lycopene in plants requires an additional isomerization step that was previously unrecognized, highlighting the incompleteness of earlier models of carotenoid biosynthesis .

What are the key genetic markers for Z-ISO in Arabidopsis thaliana?

In Arabidopsis thaliana, Z-ISO is encoded by the gene At1g10830, with ORF name T16B5.3 . The protein has EC number 5.2.1.12 and is recommended to be referred to as "15-cis-zeta-carotene isomerase, chloroplastic" . The gene encodes a protein with a full expression region from amino acids 59-367 in its mature form after transit peptide cleavage . The identification of this gene in Arabidopsis was facilitated by comparative genomics approaches following the characterization of the maize Y9 gene, demonstrating conservation of this enzymatic function across plant species .

What are the recommended storage conditions for recombinant Z-ISO protein?

Recombinant Arabidopsis thaliana Z-ISO protein should be stored at -20°C, and for extended storage, conservation at -20°C or -80°C is recommended . The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for protein stability . It is important to note that repeated freezing and thawing is not recommended, as this may lead to protein degradation or loss of enzymatic activity . For short-term use, working aliquots can be stored at 4°C for up to one week . These storage conditions are critical for maintaining the structural integrity and enzymatic activity of the protein for experimental purposes.

How can researchers verify Z-ISO enzymatic activity in vitro?

Verification of Z-ISO enzymatic activity requires a multi-step approach:

  • Substrate preparation: Generate 9,15,9′-tri-cis-ζ-carotene substrate either through extraction from appropriate mutant tissues (e.g., roots or etiolated leaves of Z-ISO mutants) or through reconstitution of the pathway up to PDS in heterologous expression systems like E. coli .

  • Activity assay: Incubate purified recombinant Z-ISO with the substrate under anaerobic conditions (as the enzyme contains heme B and may be oxygen-sensitive) .

  • Product analysis: Extract carotenoids from the reaction mixture using appropriate solvents and analyze by HPLC coupled with photodiode array detection and/or mass spectrometry to detect the conversion of 9,15,9′-tri-cis-ζ-carotene to 9,9′-di-cis-ζ-carotene .

  • Controls: Include appropriate controls such as heat-inactivated enzyme, reactions without enzyme, and positive controls (if available) to validate the specificity of the observed activity .

This approach has been successfully demonstrated in studies with the Synechocystis Z-ISO homolog (slr1599) expressed in E. coli, confirming its ζ-carotene isomerase activity .

How does Z-ISO function differ between light and dark conditions?

Z-ISO function exhibits a critical light-dependency relationship in plant carotenoid biosynthesis. In illuminated conditions, the conversion of 9,15,9′-tri-cis-ζ-carotene to 9,9′-di-cis-ζ-carotene can occur through photoisomerization, where light energy directly catalyzes the cis-to-trans conversion of the 15-15' cis double bond . This was demonstrated in a Synechocystis Δslr1599 (Z-ISO) mutant that synthesized normal carotenoid quotas when grown under illumination .

What phenotypes are associated with Z-ISO mutations in Arabidopsis?

Z-ISO mutations in Arabidopsis and other plants produce distinct phenotypes that vary by tissue type and light conditions:

Tissue TypeLight ConditionPhenotype in Z-ISO MutantsMolecular Basis
LeavesLight-grownMinimal to mild chlorosisPhotoisomerization partially compensates for Z-ISO deficiency
LeavesEtiolated (dark-grown)Pronounced chlorosis upon light exposureAccumulation of 9,15,9′-tri-cis-ζ-carotene instead of photoprotective carotenoids
RootsDark (natural condition)Reduced carotenoid contentBlocked carotenoid biosynthesis due to absence of both Z-ISO and photoisomerization
Seeds/EndospermDark (natural condition)Pale or yellow phenotype (in maize y9)Impaired carotenoid accumulation in these nutritionally important tissues

These phenotypes confirm Z-ISO's essential role in carotenoid biosynthesis in the absence of light and highlight its importance for proper plant development, especially in tissues that develop in darkness or under limited light exposure .

How conserved is Z-ISO across different plant species and photosynthetic organisms?

Z-ISO exhibits significant conservation across diverse photosynthetic organisms, particularly those that utilize the multi-enzyme poly-cis phytoene desaturation pathway . Comparative analysis reveals:

  • Angiosperms: Z-ISO has been characterized in both monocots (maize) and dicots (Arabidopsis), with high functional conservation despite some sequence divergence . The transit peptide cleavage site is predicted at residue 58 for Arabidopsis and 46 for maize Z-ISO, indicating structural adaptations while maintaining core functionality .

  • Algae and Cyanobacteria: Homologs of Z-ISO are present in these organisms, as confirmed by the identification and functional characterization of the slr1599 gene in Synechocystis sp. PCC 6803 . This suggests that Z-ISO emerged early in the evolution of oxygenic photosynthetic organisms.

  • Absence in Green Bacteria: Z-ISO homologs appear to be absent in green bacteria, which utilize different carotenoid biosynthetic pathways .

What is the evolutionary relationship between plant Z-ISO and bacterial carotenoid biosynthesis enzymes?

The evolutionary relationship between plant Z-ISO and bacterial carotenoid biosynthesis systems reveals important adaptations in pathway complexity:

Plant carotenoid biosynthesis employs a multi-enzyme system for converting 15-cis-phytoene to all-trans-lycopene, requiring two desaturases (phytoene desaturase and ζ-carotene desaturase) plus two isomerases (Z-ISO and CRTISO) . In contrast, bacteria utilize a single enzyme, CRTI, to perform the equivalent series of reactions .

This difference represents a key evolutionary divergence in carotenoid biosynthetic strategies. The plant system likely evolved greater complexity to allow for more precise regulation of carotenoid biosynthesis under varying environmental conditions, particularly in the context of light-dependent development . The discovery of Z-ISO filled a crucial knowledge gap in understanding how plants achieve the conversion of 15-cis-phytoene to all-trans-lycopene, especially in tissues where light is unavailable for photoisomerization .

The conservation of Z-ISO in cyanobacteria suggests that this more complex biosynthetic strategy predates the evolution of land plants, potentially arising during the evolution of oxygenic photosynthesis . This evolutionary perspective provides important context for understanding both the biochemical requirements and regulatory potential of the carotenoid biosynthetic pathway in different organisms.

How can Z-ISO research contribute to metabolic engineering of carotenoids in food crops?

Z-ISO research offers several strategic approaches for metabolic engineering of carotenoids in food crops:

  • Endosperm Enrichment: Understanding Z-ISO function is critical for engineering carotenoid accumulation in endosperm tissues (which develop in darkness), a primary target for nutritional improvement in cereal crops . Optimization of Z-ISO expression or activity could overcome a key bottleneck in carotenoid biosynthesis in these tissues.

  • Pathway Regulation: Z-ISO represents a regulatory control point in the carotenoid pathway that may be manipulated to enhance flux toward desired end products . Coordinated modulation of Z-ISO along with other pathway enzymes could achieve more effective redirection of metabolic flux.

  • Tissue-Specific Approaches: The differential requirement for Z-ISO between light and dark tissues suggests that tissue-specific engineering strategies should be employed, with particular attention to Z-ISO function in tissues developing without light exposure .

  • Stress Response Engineering: Given carotenoids' role in photoprotection and stress response, Z-ISO engineering could enhance plant resilience to environmental stresses while improving nutritional quality .

Successful metabolic engineering requires comprehensive knowledge of pathway enzymes and their regulation. The identification of Z-ISO filled a critical gap in this understanding, enabling more informed engineering approaches that consider all essential biosynthetic steps, particularly those that may be limiting in target tissues such as endosperm .

What technical challenges must be addressed when working with Z-ISO in heterologous expression systems?

Working with Z-ISO in heterologous expression systems presents several technical challenges that researchers must address:

  • Membrane Protein Expression: As an integral membrane protein with five predicted membrane-spanning domains, Z-ISO may face folding and stability issues when expressed in heterologous systems . Optimization of expression conditions, use of fusion tags, and selection of appropriate host systems (such as E. coli strains designed for membrane protein expression) may be necessary.

  • Cofactor Incorporation: Z-ISO is a heme B-containing enzyme, requiring proper incorporation of this cofactor for activity . Ensuring adequate heme availability and incorporation during heterologous expression is essential for obtaining functional protein.

  • Functional Assays: Verifying Z-ISO activity requires access to its specific substrate, 9,15,9′-tri-cis-ζ-carotene, which is not commercially available . This necessitates either co-expression with upstream enzymes to generate the substrate in vivo or development of complex in vitro assay systems.

  • Oxygen Sensitivity: As a heme-containing enzyme, Z-ISO may exhibit oxygen sensitivity, potentially requiring anaerobic conditions for activity assays .

  • Photoisomerization Interference: Light can catalyze the isomerization reaction non-enzymatically, potentially confounding activity assays . Strict light control during expression and assays is necessary to distinguish enzymatic from photochemical isomerization.

Addressing these challenges requires careful experimental design and may involve specialized expression systems, purification protocols, and assay conditions tailored to the unique properties of Z-ISO as a membrane-bound, heme-containing isomerase.

How does Z-ISO function integrate with broader plant stress response pathways?

Research is revealing that Z-ISO function interconnects with plant stress response networks in several significant ways:

Carotenoids serve essential functions in photoprotection against excess light, and their biosynthesis is regulated in response to environmental stressors . Z-ISO, as a critical enzyme in carotenoid biosynthesis, appears to be integrated into regulatory networks that modulate plant responses to various stresses:

  • Light Stress Response: The dual mechanism of isomerization (enzymatic via Z-ISO and photochemical) may serve as a regulatory node that adjusts carotenoid biosynthesis based on light intensity and quality . This potentially links Z-ISO function to photomorphogenic signaling pathways.

  • Transcriptional Regulation: Research in Arabidopsis has identified transcription factors, particularly Phytochrome-Interacting Factors (PIFs), that directly regulate carotenoid biosynthesis genes during light-triggered processes such as deetiolation . Investigation of whether these or other transcription factors specifically regulate Z-ISO expression would provide insight into its role in stress-responsive carotenoid biosynthesis.

  • Integration with Immune Responses: Arabidopsis research on extracellular DNA responses suggests complex signaling networks involving chloroplast function and reactive oxygen species (ROS) production . Given carotenoids' role in ROS scavenging and Z-ISO's localization to chloroplasts, there may be unexplored connections between Z-ISO function and immune response pathways.

Further research is needed to fully elucidate how Z-ISO regulation interfaces with broader stress response networks and how this integration may be leveraged for crop improvement strategies.

What are the challenges in structural biology studies of Z-ISO?

Structural biology studies of Z-ISO face several significant challenges that have limited our understanding of its three-dimensional structure and catalytic mechanism:

  • Membrane Protein Crystallization: As an integral membrane protein with five predicted transmembrane domains, Z-ISO presents the typical challenges associated with membrane protein crystallography, including difficulties in expression, purification, and crystal formation .

  • Heme Cofactor Complexity: The presence of a heme B cofactor adds another layer of complexity to structural studies, requiring maintenance of the native protein-cofactor interaction throughout purification and crystallization processes .

  • Substrate Accessibility: The substrate, 9,15,9′-tri-cis-ζ-carotene, is a hydrophobic molecule that likely interacts with Z-ISO within the membrane environment. Capturing this interaction in structural studies presents significant technical challenges .

  • Alternative Approaches: In the absence of a crystal structure, researchers have turned to computational modeling approaches. Recent studies have utilized AlphaFold to generate structural models of Z-ISO from Synechocystis, maize, and Arabidopsis, identifying putative heme ligands and substrate-binding sites . These computational approaches, combined with biochemical and mutagenesis studies, offer alternative routes to understanding Z-ISO structure-function relationships.

Progress in structural biology techniques for membrane proteins, including advances in cryo-electron microscopy and computational methods, may eventually overcome these challenges and provide direct structural insights into Z-ISO function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.