Recombinant Arabidopsis thaliana 3-epi-6-deoxocathasterone 23-monooxygenase (ROT3)

Shipped with Ice Packs
In Stock

Description

Introduction

Arabidopsis thaliana 3-epi-6-deoxocathasterone 23-monooxygenase, commonly known as ROTUNDIFOLIA3 (ROT3), is an enzyme that belongs to the cytochrome P-450 superfamily and plays a vital role in the polar elongation of cells in Arabidopsis thaliana . The ROT3 gene encodes a cytochrome P-450 (CYP90C1) that shares similarities with steroid hydroxylases found in both animals and plants .

Gene Discovery and Cloning

The ROT3 gene was first identified through the characterization of the rotundifolia3 (rot3) mutant in Arabidopsis, which exhibited defects in the polar elongation of leaf cells . Map-based cloning and T-DNA tagging were employed to isolate the ROT3 gene, and its identity was confirmed through molecular analysis of three rot3 mutant alleles obtained from different mutagenesis experiments .

Protein Function and Characteristics

ROT3 is a cytochrome P-450 monooxygenase, specifically CYP90C1, which implies its involvement in oxidation reactions. Cytochrome P-450 enzymes are known for catalyzing diverse reactions, often involving the insertion of an oxygen atom into a substrate molecule. ROT3 is crucial for the regulated polar elongation of leaf cells . Higher expression of the ROT3 gene is observed in tissues with high cell division activity .

Expression Patterns

The expression of the ROT3 gene is detectable in all major organs of Arabidopsis thaliana . This suggests that ROT3 plays a role in various developmental processes throughout the plant.

Evolutionary Context

The redox gene network analysis in Arabidopsis thaliana provides insights into the evolutionary history of redox components . Class III peroxidases, which interact with ROT3-related pathways, are among the most recent components in the network, indicating an expansion of this class of peroxidases in plants .

Tables and Data

Because the performance measures can deliver a thorough grasp of its classification proficiency, the tables below demonstrate models' efficacy .

Table 1: Performance measures of a model across 38 distinct classes of a dataset .

MetricDescription
PrecisionQuantifies the ratio of real positive predictions to the total predicted positives, indicating the model’s accuracy in class identification .
RecallMeasures the capacity to identify all pertinent events within each category .
F1-scoreIntegrates precision and recall, offering a fair assessment of the model’s efficacy .
SupportDenotes the quantity of test samples for each class, hence contextualizing performance measurements according to class size .
AUCMeasures the separability, with elevated scores for the majority of classes signifying robust discriminatory power . ROC curves are essential for visually evaluating the model’s capacity to differentiate between classes . Demonstrates the model’s classification performance across all classes .

Table 2: Comparison of the proposed method with existing models based on performance and computational efficiency .

ModelPerformanceComputational Efficiency
Existing Model AElevated accuracy, precision, recall, and F1-scores across most classes .Problems are evident in instances such as “Corn (maize) Cercospora leaf spot” and “Potato healthy ."
Arabidopsis thalianaThe model exhibits remarkable performance in a wide range of classification tasks, maintaining a consistent level of accuracy . The ROT3 gene controls polar elongation specifically in leaf cells .Higher expression was detected in the tissues that had high activity of cell division .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
CYP90C1; ROT3; At4g36380; AP22.10; C7A10.980; F23E13.220; 3-epi-6-deoxocathasterone 23-monooxygenase CYP90C1; Cytochrome P450 90C1; Protein ROTUNDIFOLIA 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-524
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ROT3
Target Protein Sequence
MQPPASAGLFRSPENLPWPYNYMDYLVAGFLVLTAGILLRPWLWLRLRNSKTKDGDEEED NEEKKKGMIPNGSLGWPVIGETLNFIACGYSSRPVTFMDKRKSLYGKVFKTNIIGTPIII STDAEVNKVVLQNHGNTFVPAYPKSITELLGENSILSINGPHQKRLHTLIGAFLRSPHLK DRITRDIEASVVLTLASWAQLPLVHVQDEIKKMTFEILVKVLMSTSPGEDMNILKLEFEE FIKGLICIPIKFPGTRLYKSLKAKERLIKMVKKVVEERQVAMTTTSPANDVVDVLLRDGG DSEKQSQPSDFVSGKIVEMMIPGEETMPTAMTLAVKFLSDNPVALAKLVEENMEMKRRKL ELGEEYKWTDYMSLSFTQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGWCVLASFI SVHMDEDIYDNPYQFDPWRWDRINGSANSSICFTPFGGGQRLCPGLELSKLEISIFLHHL VTRYSWTAEEDEIVSFPTVKMKRRLPIRVATVDDSASPISLEDH
Uniprot No.

Target Background

Function

Recombinant Arabidopsis thaliana 3-epi-6-deoxocathasterone 23-monooxygenase (ROT3) is involved in brassinosteroid (BR) biosynthesis. It catalyzes the conversion of typhasterol to castasterone and 6-deoxotyphasterol to 6-deoxocastasterone. As a C-23 hydroxylase, ROT3 directly converts (22S,24R)-22-hydroxy-5-alpha-ergostan-3-one and 3-epi-6-deoxocathasterone to 3-dehydro-6-deoxoteasterone and 6-deoxotyphasterol, respectively. These C-23 hydroxylation reactions provide alternative pathways, bypassing campestanol, 6-deoxocathasterone, and 6-deoxoteasterone. ROT3 is essential for regulating polar elongation of leaf cells and the longitudinal elongation of floral organs.

Gene References Into Functions
  1. ROT3 modulates ethylene-induced petiole movement. PMID: 23264517
Database Links

KEGG: ath:AT4G36380

STRING: 3702.AT4G36380.1

UniGene: At.19730

Protein Families
Cytochrome P450 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is the molecular identity of the ROT3 gene and its encoded protein?

The ROT3 gene of Arabidopsis thaliana encodes a cytochrome P-450 protein classified as CYP90C1. The gene spans approximately 6 kb of genomic DNA and consists of nine exons with consensus splice sites at exon-intron boundaries . The predicted ROT3 protein consists of 524 amino acids with a calculated molecular mass of 59.4 kD .

Structurally, ROT3 contains domains homologous to conserved amino-terminal membrane-anchoring, proline-rich, oxygen- and heme-binding domains characteristic of microsomal cytochrome P-450s . The protein exhibits strongest homology (36%) to CYP90A1, a known cathasterone C23-hydroxylase involved in brassinosteroid biosynthesis .

What phenotypes are associated with ROT3 mutations?

ROT3 mutants exhibit distinctive phenotypic characteristics including:

  • Short petioles

  • Round leaf blades (as opposed to the more elongated wild-type leaves)

  • Defects in polar expansion of leaf cells

  • Abnormal stems (specifically in the rot3-2 allele)

Importantly, the roots and hypocotyls of rot3 mutants appear normal compared to wild-type plants . Light microscopy examination reveals that the altered leaf dimensions in rot3 mutants result from changes in cell length in the leaf-length direction rather than alterations in cell number .

What is the expression pattern of the ROT3 gene?

RT-PCR analysis indicates that ROT3 is expressed in all major plant organs. The gene shows particularly high expression in tissues with elevated cell division activity, including:

  • Suspension culture cells

  • Roots

  • 7-day-old seedlings

  • Floral buds

Expression is comparatively lower in cotyledons, which have a reduced rate of cell division . This expression pattern suggests ROT3 plays a general role in cell elongation throughout plant development, with particular importance in actively dividing tissues.

How have ROT3 mutant alleles been isolated and characterized?

Three distinct rot3 mutant alleles have been isolated through different mutagenesis approaches:

AlleleMutagenesis MethodMolecular LesionEffect on TranscriptPhenotype
rot3-1Fast neutron irradiationDeletion of ≥1 kbNo detectable transcriptShort petioles, round leaves
rot3-2EMS mutagenesisSingle base-pair substitution (Gly-80→Glu)Normal transcript levelsShort petioles, round leaves, abnormal stems
rot3-3T-DNA insertionT-DNA in promoter regionDramatically reduced transcriptShort petioles, round leaves

Each mutant was initially identified based on characteristic short petioles and round leaves . Allelism tests confirmed that all three mutations affected the same locus . The rot3-3 allele was isolated from a screening of approximately 22,000 seeds from Arabidopsis lines harboring T-DNA insertions .

How was the ROT3 gene cloned and confirmed?

The ROT3 gene was cloned using a T-DNA tagging method, with the T-DNA insertion in the rot3-3 allele serving as a molecular marker . The identity of the cloned gene was confirmed through molecular analysis of all three rot3 mutant alleles, each obtained through different mutagenesis methods .

Confirmation involved:

  • Southern hybridization analysis to detect the deletion in rot3-1

  • Sequencing to identify the point mutation in rot3-2

  • Mapping the T-DNA insertion site in rot3-3

What is the hypothesized enzymatic function of ROT3?

Based on sequence homology, ROT3 (CYP90C1) appears to be a cytochrome P-450 monooxygenase with putative steroid hydroxylase activity . Its homology to known steroid hydroxylases suggests potential involvement in brassinosteroid biosynthesis or a related steroid metabolism pathway.

  • Dark-grown rot3 seedlings show normal skotomorphogenesis (unlike brassinosteroid-deficient mutants)

  • rot3 mutants do not exhibit dwarfism under light conditions (a characteristic of brassinosteroid mutants)

  • Application of exogenous brassinosteroid does not restore the wild-type phenotype in rot3 mutants

These findings suggest ROT3 may catalyze the synthesis of novel factors affecting cell elongation specifically in leaves.

How does ROT3 specifically affect polar cell elongation?

ROT3 appears to regulate the direction and extent of cell elongation specifically in leaf cells . The protein influences polar expansion by:

  • Controlling cell elongation predominantly in the leaf-length direction

  • Acting in a tissue-specific manner (affecting leaves more than roots or stems)

  • Potentially synthesizing factors in dividing cells that communicate with elongating cells

This function appears to be independent of known plant hormone pathways, as treatment with gibberellic acids or auxin does not restore normal phenotype in rot3 mutants . The organ-specific effects suggest different pathways might exist for cell expansion in roots, stems, and foliage leaves, despite ROT3 being expressed in all these tissues .

What are effective strategies for isolating and analyzing new rot3 alleles?

Researchers seeking to generate and characterize new rot3 alleles should consider these methodological approaches:

  • Mutagenesis techniques:

    • Fast neutron irradiation for creating deletions

    • EMS treatment for point mutations

    • T-DNA insertion for gene disruption

  • Screening methods:

    • Visual identification of plants with short petioles and round leaves

    • PCR-based verification of mutations in the ROT3 locus

    • Allelism tests through crosses with known rot3 mutants

  • Molecular characterization:

    • Southern hybridization to detect large rearrangements

    • DNA sequencing to identify specific mutations

    • RT-PCR to assess transcript levels

  • Phenotypic analysis:

    • Detailed morphometric measurements of leaves and other organs

    • Microscopic examination of cell dimensions

    • Comparison of growth under different environmental conditions

What techniques can be used to express and purify recombinant ROT3 protein?

Expression and purification of functional recombinant ROT3 protein presents several technical challenges typical of membrane-associated cytochrome P-450 enzymes:

  • Expression systems:

    • Yeast expression systems (e.g., Pichia pastoris) often provide better folding for plant P-450s

    • Insect cell systems may preserve enzymatic activity better than bacterial systems

    • N-terminal modifications to remove membrane-anchoring domains can improve solubility

  • Purification considerations:

    • Detergent solubilization for membrane-bound forms

    • Affinity tags (His, GST, etc.) for simplified purification

    • Size exclusion chromatography to ensure monodispersity

  • Activity validation:

    • Spectrophotometric confirmation of heme incorporation (CO-difference spectrum)

    • In vitro assays with potential steroid substrates

    • Mass spectrometry to identify reaction products

For functional studies, co-expression with cytochrome P-450 reductase is often necessary to provide electrons for the catalytic cycle.

How can researchers investigate ROT3's possible role in novel steroid biosynthesis pathways?

To determine whether ROT3 functions in a novel steroid biosynthesis pathway distinct from known brassinosteroid pathways, consider these experimental approaches:

  • Metabolomic analysis:

    • Comparative LC-MS/MS profiling of steroids in wild-type versus rot3 mutant plants

    • Isotope labeling experiments to track steroid precursor metabolism

    • Analysis of steroid intermediate accumulation patterns

  • Enzymatic assays:

    • In vitro assays with recombinant ROT3 and various steroid substrates

    • Kinetic analysis to determine substrate preferences

    • Product characterization by mass spectrometry

  • Genetic approaches:

    • Creation of double mutants between rot3 and other steroid biosynthesis mutants

    • Complementation studies with genes encoding related enzymes

    • Tissue-specific ROT3 expression to determine rescue capabilities

What methods can determine the tissue-specific requirements for ROT3 activity?

The ROT3 transcript is detected in multiple organs, yet the mutant phenotype affects primarily leaf morphology . To investigate this tissue-specific requirement:

  • Cell-type specific expression:

    • Generate transgenic plants expressing ROT3 under various tissue-specific promoters

    • Quantify phenotypic rescue in different tissues and cell types

    • Combine with fluorescent tagging to visualize protein localization

  • Inducible expression systems:

    • Use chemical or heat-shock inducible promoters to activate ROT3 at specific developmental stages

    • Monitor changes in cell elongation patterns following induction

    • Determine critical windows for ROT3 function

  • Detailed cellular analysis:

    • High-resolution imaging of cell wall deposition patterns in rot3 versus wild-type

    • Immunolocalization studies of cell expansion markers

    • Correlate ROT3 expression with local cell expansion dynamics

How does ROT3 function integrate with other cell elongation pathways?

Despite extensive characterization, several questions remain about how ROT3 integrates with other regulators of cell elongation:

  • Signal integration questions:

    • How does ROT3 activity coordinate with known hormonal pathways?

    • Does ROT3 function downstream of specific transcription factors?

    • What are the immediate targets of ROT3-mediated regulation?

  • Methodological approaches:

    • Transcriptome analysis of rot3 mutants at different developmental stages

    • Chromatin immunoprecipitation to identify transcription factors regulating ROT3

    • Protein-protein interaction studies to identify ROT3 partners

  • Comparative analysis:

    • Analysis of cell elongation patterns in rot3 versus other cell expansion mutants

    • Investigation of genetic interactions through double mutant analysis

    • Evaluation of ROT3 expression in response to various cell expansion signals

What evolutionary insights can be gained from studying ROT3 orthologs?

ROT3 represents an intriguing component of plant development with potential evolutionary significance:

  • Comparative genomic approaches:

    • Identification and functional characterization of ROT3 orthologs across plant lineages

    • Analysis of selection pressures on different protein domains

    • Correlation between ROT3 sequence variation and leaf morphology diversity

  • Experimental methods:

    • Cross-species complementation studies using ROT3 orthologs from diverse plants

    • Expression pattern comparison across species

    • Functional analysis of chimeric proteins combining domains from different species

The study of ROT3 orthologs could provide insights into the evolution of leaf shape determination and cell elongation mechanisms across the plant kingdom.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.