Recombinant Arabidopsis thaliana 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 (HMG1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HMG1; HMGR1; At1g76490; F14G6.9; F15M4.1; 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1; AtHMGR1; HMG-CoA reductase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-592
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
HMG1
Target Protein Sequence
MDLRRRPPKPPVTNNNNSNGSFRSYQPRTSDDDHRRRATTIAPPPKASDALPLPLYLTNA VFFTLFFSVAYYLLHRWRDKIRYNTPLHVVTITELGAIIALIASFIYLLGFFGIDFVQSF ISRASGDAWDLADTIDDDDHRLVTCSPPTPIVSVAKLPNPEPIVTESLPEEDEEIVKSVI DGVIPSYSLESRLGDCKRAASIRREALQRVTGRSIEGLPLDGFDYESILGQCCEMPVGYI QIPVGIAGPLLLDGYEYSVPMATTEGCLVASTNRGCKAMFISGGATSTVLKDGMTRAPVV RFASARRASELKFFLENPENFDTLAVVFNRSSRFARLQSVKCTIAGKNAYVRFCCSTGDA MGMNMVSKGVQNVLEYLTDDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAVIRG EIVNKVLKTSVAALVELNMLKNLAGSAVAGSLGGFNAHASNIVSAVFIATGQDPAQNVES SQCITMMEAINDGKDIHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASTESPGMNA RRLATIVAGAVLAGELSLMSAIAAGQLVRSHMKYNRSSRDISGATTTTTTTT
Uniprot No.

Target Background

Function
This recombinant Arabidopsis thaliana 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 (HMG1) catalyzes the synthesis of mevalonate, a key precursor for all isoprenoid compounds in plants.
Gene References Into Functions
  • The membrane domain of HMGR contributes to endoplasmic reticulum morphogenesis in plant cells. PMID: 26015445
  • Subcellular localization of the gene's expression in A. thaliana. PMID: 15618432
  • HMG1 overexpression increases essential oil yield in spike lavender. PMID: 17714440
Database Links

KEGG: ath:AT1G76490

STRING: 3702.AT1G76490.1

UniGene: At.22772

Protein Families
HMG-CoA reductase family
Subcellular Location
[Isoform Short]: Endoplasmic reticulum membrane; Multi-pass membrane protein.; [Isoform Long]: Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Found in all tissues. Isoform Short is expressed at low levels specifically in flowers. Expressed in both the tapetum and microspores.

Q&A

What is the structural organization of Arabidopsis HMG1 and how does it differ from HMG-CoA reductases in other organisms?

Arabidopsis thaliana HMG1 encodes 3-hydroxy-3-methylglutaryl-CoA reductase (EC 1.1.1.88), which catalyzes the conversion of HMG-CoA to mevalonate in the isoprenoid biosynthesis pathway. The protein has a distinct structure compared to HMG-CoA reductases from other organisms. DNA sequence analysis reveals that while the COOH-terminal domain (containing the catalytic site) is highly conserved across species, the membrane-bound amino terminus of the Arabidopsis protein is truncated and lacks the complex membrane-spanning architecture found in yeast and animal reductases .

Recent crystallographic data reveals that Arabidopsis HMG1 (AtHMG1) exhibits a wider active site than previously determined structures from different species . This unique structural feature has implications for substrate specificity and enables the rational design of specific inhibitors. The structural conservation of the catalytic domain, despite sequence divergence in other regions, underscores the evolutionary importance of this enzyme.

How can I distinguish between HMG1 as 3-hydroxy-3-methylglutaryl-CoA reductase and HMG1-like proteins in Arabidopsis?

In Arabidopsis research, there can be confusion between two distinct protein families that share the "HMG" designation:

  • HMG1 (3-hydroxy-3-methylglutaryl-CoA reductase) - An enzyme involved in isoprenoid biosynthesis that catalyzes the conversion of HMG-CoA to mevalonate.

  • HMG1-like proteins - Chromatin-associated high-mobility-group proteins that function as architectural elements in chromatin.

These protein families differ in several key aspects:

CharacteristicHMG1 (HMG-CoA reductase)HMG1-like proteins
FunctionMetabolic enzyme in isoprenoid biosynthesisChromatin-associated architectural proteins
Subcellular locationEndoplasmic reticulum membraneNucleus, with speckled distribution in chromatin
Structural domainsCatalytic domain + membrane domainHMG domain or AT-hook DNA binding motifs
Molecular weight~60 kDaVariable (multiple forms: HMGα, HMGβ, HMGγ, HMGδ)

When studying these proteins, researchers should carefully specify which HMG family they are investigating and confirm identity through sequence analysis or functional assays .

What experimental approaches can be used to assess HMG1 enzyme activity?

Several methodological approaches can be employed to assess HMG1 enzyme activity:

  • Heterologous expression and complementation: The functionality of Arabidopsis HMG1 can be confirmed by expressing it in yeast mutants lacking endogenous HMG-CoA reductase activity. The ability of the plant gene to suppress the growth defect of yeast hmg- mutants provides strong evidence of functional enzyme activity .

  • Biochemical enzyme assays: Direct measurement of HMG-CoA reductase activity using purified recombinant protein or plant extracts, monitoring the NADPH-dependent conversion of HMG-CoA to mevalonate.

  • Inhibitor studies: Specific inhibitors like lovastatin can be used to assess enzyme function in vivo. For example, lovastatin treatment mimics hmg1 knockout mutations, affecting germination, cotyledon emergence, and primary root growth .

  • Sterol quantification: As HMG1 is essential for sterol biosynthesis, sterol levels can serve as a proxy for enzyme activity. Gas chromatography analysis of steryl acetates can be used to quantify sterols, as demonstrated in mad3 mutants carrying the R458H substitution in HMG1, which showed a 40% reduction in leaf sterols and 60% reduction in flower sterols .

  • Mutant phenotype rescue: Feeding experiments with pathway intermediates (e.g., squalene) can rescue phenotypes in hmg1 mutants, confirming that observed defects result from reduced HMG1 activity .

How is HMG1 expression regulated in Arabidopsis tissues?

HMG1 expression in Arabidopsis is subject to complex regulatory mechanisms that respond to developmental cues and environmental factors:

  • Tissue specificity: HMG1 is expressed in various tissues including leaves, inflorescences, and roots, though expression levels may vary across tissues.

  • Gravitational regulation: HMG1 expression is upregulated in Arabidopsis hypocotyls grown under hypergravity conditions, suggesting gravitational stress modulates its expression .

  • Microgravity response: Under microgravity conditions in space experiments, the expression of a series of genes involved in isoprenoid and sterol biosynthesis pathways, including HMG1, was suppressed in the apical region of inflorescences .

  • Developmental regulation: HMG1 expression patterns change during plant development, with particularly important roles during flowering and seed development, as evidenced by the bolting suppression phenotype of hmg1 mutants under microgravity conditions .

Researchers investigating HMG1 expression should consider these regulatory factors when designing experiments and interpreting results, particularly when studying plants under different gravitational or stress conditions.

What methods are most effective for quantifying HMG1 expression levels?

Multiple techniques can be employed to quantify HMG1 expression levels in Arabidopsis:

  • Quantitative Real-Time PCR (qRT-PCR): This is a highly sensitive method for quantifying HMG1 mRNA levels. When designing primers, researchers should ensure specificity to distinguish between HMG1 and other related genes .

  • RNA-seq analysis: This approach provides comprehensive transcriptome profiling, allowing measurement of HMG1 expression in the context of global gene expression patterns. RNA-seq has been successfully employed to examine expression of sterol biosynthesis genes in Arabidopsis inflorescences under different gravitational conditions .

  • Microarray analysis: Though largely superseded by RNA-seq, microarray analysis using platforms such as the Arabidopsis Gene 1.0 ST Array (Affymetrix GeneChip) has been used to assess HMG1 expression .

  • Western blotting: For protein-level detection, western blotting with specific antibodies against HMG1 can be used. This approach revealed elevated levels of mutant hmg1 R458H protein in the mad3 mutant compared to wild-type plants .

  • Subcellular fractionation: Combined with western blotting, this technique can determine the distribution of HMG1 protein between membrane and soluble fractions, providing insights into its localization and potential activity .

For most accurate results, researchers are advised to use multiple complementary approaches when possible, as each method has specific strengths and limitations.

What are the key phenotypes associated with hmg1 mutations and how do they inform our understanding of HMG1 function?

Arabidopsis hmg1 mutants display several distinctive phenotypes that provide insights into the diverse functions of this enzyme:

  • Growth and development abnormalities: The hmg1 mutant shows reduced sterol levels compared to wild-type plants, leading to pleiotropic phenotypes affecting cell growth, senescence, and fertility. These phenotypes can be rescued by feeding with squalene, confirming they result from sterol deficiency .

  • Gravitropic responses: Under microgravity conditions in space, hmg1 mutants show normal development up to rosette leaf growth but exhibit strong suppression of bolting (inflorescence stem elongation) . This indicates that HMG1 plays a critical role in the plant's ability to develop normally in the absence of gravitational cues.

  • miRNA function defects: The mad3 mutation (R458H substitution in HMG1) causes defects in miRNA-guided repression without affecting miRNA levels themselves. This results in increased accumulation of miRNA targets including CSD2, SCL6-IV, and APS proteins .

  • Male gametophytic lethality: Complete knockout alleles of hmg1 are male gametophytic-lethal when combined with mutations in HMG2 (the other HMG-CoA reductase in Arabidopsis), highlighting the essential nature of this enzyme for plant reproduction .

These diverse phenotypes demonstrate that HMG1 influences multiple developmental and regulatory processes beyond its direct enzymatic role in isoprenoid biosynthesis.

How do HMG1 inhibitors affect plant development and what does this reveal about HMG1 function?

Chemical inhibition of HMG1 provides valuable insights into its function:

  • Lovastatin effects: This specific HMG1 inhibitor causes effects similar to hmg1 knockout mutations, affecting approximately 30% of treated plants which exhibit morphological defects resembling those of the mad3 mutant . Lovastatin treatment disrupts miRNA function, as evidenced by higher GFP accumulation in a miR171-targeted GFP reporter line (GFP171.1).

  • F-244 inhibition: This HMGS inhibitor retards primary root growth in Arabidopsis seedlings by reducing stigmasterol, auxin, and cytokinin levels . Proteomic analysis revealed that inhibition of HMGS (which acts upstream of HMG1) activated glucosinolate biosynthesis, establishing a regulatory relationship between the MVA pathway and glucosinolate biosynthesis.

  • Hypergravity simulation: In the presence of lovastatin, modifications of growth parameters characteristic of hypergravity conditions (suppressed elongation growth and stimulated lateral expansion) occur even under normal gravity conditions . This suggests that HMG1 mediates responses to gravitational stress.

  • Lipid raft disruption: HMG1 inhibition affects sterol-rich membrane microdomains (lipid rafts), which are important for protein localization and signaling. This may explain the effect of HMG1 inhibition on processes like miRNA function, as AGO1 (a key protein in miRNA pathways) is a peripheral membrane protein .

These inhibitor studies complement genetic approaches and provide temporal control over HMG1 activity, offering insights into its roles throughout development.

What advantages does heterologous expression of Arabidopsis HMG1 in yeast offer for functional studies?

Heterologous expression of Arabidopsis HMG1 in yeast provides several key advantages for functional studies:

  • Functional complementation: Expression of Arabidopsis HMG1 from the yeast GAL1 promoter in a yeast mutant lacking HMG-CoA reductase activity suppresses the growth defect of the yeast mutant . This provides strong evidence that the Arabidopsis gene encodes a functional HMG-CoA reductase enzyme.

  • Mutant analysis: The yeast system allows efficient assessment of the functionality of mutant versions of HMG1. For example, while wild-type HMG1 fully complemented the Δhmg1Δhmg2 yeast double-mutant regardless of MVA availability, the HMG1 R458H variant (from the mad3 mutant) displayed clear growth defects on MVA-free medium . This demonstrated that the R458H mutation results in reduced catalytic activity.

  • Structure-function studies: The yeast system facilitates analysis of protein domains and critical residues. The ability of the plant gene to function in yeast despite significant structural differences, particularly in the membrane-spanning domain, provides insights into the essential regions required for activity .

  • Controlled expression: Using inducible promoters like GAL1 allows controlled expression of the plant enzyme, enabling studies of dosage effects or expression timing.

  • Simplified genetic background: The yeast system lacks the complexity and redundancy of plant isoprenoid pathways, allowing clearer interpretation of HMG1 function without interference from related plant enzymes or compensatory mechanisms.

This complementation approach has been instrumental in confirming the identity and functionality of Arabidopsis HMG1 and characterizing the effects of mutations.

How does HMG1 activity affect sterol content and membrane function in plants?

HMG1 plays a critical role in determining membrane sterol content and function in Arabidopsis:

  • Sterol biosynthesis regulation: As the enzyme catalyzing the first committed step in isoprenoid biosynthesis, HMG1 is essential for the production of sterols. The mad3 mutation (R458H) in HMG1 leads to reduced catalytic activity and consequently lower sterol levels - a 40% reduction in leaves and 60% reduction in flowers .

  • Membrane integrity: Sterols are crucial components of cell membranes, affecting membrane fluidity, permeability, and the formation of specialized microdomains. The hmg1 mutant has lower sterol levels than wild-type plants, leading to pleiotropic phenotypes that can be rescued by feeding with squalene .

  • Lipid raft formation: Sterols are enriched in lipid rafts, which are microdomains in the plasma membrane important for protein localization and signaling. Proper sterol levels maintained through HMG1 activity are necessary for normal membrane structure and function, including the association of proteins like AGO1 with membranes .

  • Protein targeting: HMG1 activity affects membrane-protein associations. For example, knockdown of HMG1 reduces the levels of membrane-associated AGO1 (a key protein in miRNA pathways), suggesting that HMG1-dependent membrane integrity is necessary for proper AGO1 localization and function .

  • Gravitational responses: Changes in HMG1 expression and consequently sterol levels may be involved in plant responses to gravitational stress, affecting membrane properties and cell growth patterns .

These findings highlight the fundamental importance of HMG1 in maintaining proper membrane composition and function, with widespread effects on plant development and responses to environmental conditions.

What is the relationship between HMG1 and microRNA function in Arabidopsis?

Research has revealed a surprising and important connection between HMG1 and microRNA function in Arabidopsis:

  • miRNA activity requirement: The mad3 mutation (R458H) in HMG1 leads to defects in miRNA-guided repression without affecting miRNA levels themselves . This indicates that HMG1 is required for miRNA activity rather than miRNA biogenesis.

  • AGO1 membrane association: ARGONAUTE1 (AGO1), a key protein in the miRNA pathway, was found to be a peripheral membrane protein in Arabidopsis. Notably, knockdown of HMG1 reduced the levels of membrane-associated AGO1, suggesting that HMG1-dependent membrane integrity is necessary for proper AGO1 localization and function .

  • Pharmacological evidence: Treatment with lovastatin, a specific inhibitor of HMG1, resulted in higher accumulation of a GFP reporter that is normally silenced by miR171, similar to the effect seen in the mad3 mutant . This confirms that the enzymatic activity of HMG1 in isoprenoid biosynthesis is necessary for normal miRNA function.

  • Structural insights: The mad3 mutation affects amino acid R458, which is not directly involved in catalysis but results in reduced enzymatic activity. This finding revealed that even partial reduction in HMG1 function can significantly impact miRNA activity .

  • Membrane compartment role: This relationship suggests that in plants, as in animal cells, silencing complexes may associate with endomembranes, and that proper membrane composition facilitated by HMG1 is crucial for this association .

This connection between isoprenoid biosynthesis and gene silencing mechanisms represents an important intersection between metabolic and regulatory processes in plants.

How does HMG1 activity impact other metabolic pathways, particularly glucosinolate biosynthesis?

HMG1 activity has surprising cross-pathway effects on plant metabolism:

This cross-pathway regulation demonstrates how HMG1 and the isoprenoid biosynthesis pathway integrate with other aspects of plant metabolism to coordinate growth, development, and defense responses.

How can the crystal structure of Arabidopsis HMG1 inform herbicide development and crop protection strategies?

The crystal structure of Arabidopsis HMG1 provides valuable insights for agricultural applications:

  • Unique active site architecture: The crystal structure reveals that Arabidopsis HMG1 (AtHMG1) exhibits a wider active site than previously determined structures from different species . This structural feature enables the rational design of specific inhibitors that could selectively target plant HMG1 while sparing non-plant versions of the enzyme.

  • Potential herbicide development: The distinctive features of plant HMG-CoA reductase suggest it could represent a viable herbicide target. Researchers have proposed that HMGR could be a new herbicide mode-of-action, addressing the challenge of herbicide resistance in weeds .

  • Tolerance trait engineering: Analysis of fungal gene clusters has enabled the development of a tolerance trait for HMG1-targeting compounds . This suggests the possibility of creating herbicide-resistant crops through targeted modifications to HMG1 based on structural insights.

  • Structure-guided inhibitor design: The detailed structural information allows for the design of inhibitors with improved specificity and potency against plant HMG1. This rational design approach may yield compounds with fewer off-target effects and better environmental profiles than current herbicides.

  • Cross-species comparisons: Structural comparisons between AtHMG1 and HMG-CoA reductases from different species can identify conserved and divergent features, informing the development of species-selective inhibitors for targeted weed control.

These structural insights open new possibilities for developing novel agricultural tools while also deepening our understanding of fundamental differences in isoprenoid biosynthesis across kingdoms.

What are the effects of microgravity on HMG1 function and how can this inform space agriculture research?

Space experiments have revealed fascinating effects of microgravity on HMG1 function:

  • Bolting suppression: Under microgravity conditions on the International Space Station, the hmg1 mutant showed strong suppression of bolting (elongation of the inflorescence stem) while maintaining normal development up to the rosette leaf stage . This indicates that HMG1 is particularly important for normal development in the absence of gravitational cues.

  • Gene expression changes: In the apical region of inflorescences, the expression of genes involved in isoprenoid and sterol biosynthesis pathways was suppressed under microgravity conditions . This suggests that gravitational changes trigger transcriptional reprogramming of metabolism.

  • Sterol biosynthesis regulation: The results suggest that a severe reduction in sterol levels due to the hmg1 mutation, combined with downregulation of sterol biosynthesis gene expression under microgravity, leads to the observed developmental phenotypes .

  • Experimental methodology: The Resist Tubule space experiment conducted on the Kibo Module of the International Space Station provides a methodological framework for studying plant growth and development under microgravity conditions . Seeds were germinated in rockwool with nutrient solution, and plants were grown under both microgravity and artificial 1g conditions.

These findings have important implications for space agriculture:

  • Plant sterol metabolism may need to be optimized for space cultivation

  • HMG1 could be a target for genetic modification to improve plant growth under microgravity

  • The differential sensitivity of developmental stages to microgravity suggests critical windows for intervention

  • Understanding the intersection of gravitational sensing and metabolism could inform cultivation strategies

What methodological approaches can be used to study the membrane association of proteins dependent on HMG1 activity?

Several sophisticated approaches can be employed to study membrane protein associations dependent on HMG1:

  • Subcellular fractionation: Analysis of soluble and insoluble fractions upon hypertonic lysis fragments membrane compartments into microsomes. This approach revealed that a sizeable fraction of AGO1 is in the insoluble pellet along with the transmembrane protein HMG1 .

  • Differential extraction protocols: Treatments with various solutions can distinguish between types of membrane association:

    • Mild detergent (0.5% Triton X-100): Extracts peripheral membrane proteins

    • High-salt or alkaline solutions: Extracts proteins that don't use hydrophobic interactions for membrane association

    These methods revealed that AGO1 is a peripheral membrane protein rather than an integral membrane protein like HMG1, which has two transmembrane segments .

  • Protein-membrane interaction analysis: Comparing wild-type plants with hmg1 mutants showed that knockdown of HMG1 reduced membrane-associated AGO1 levels while total AGO1 levels remained unchanged . This approach can identify proteins whose membrane association depends on proper sterol content.

  • Lipid raft isolation: Density gradient centrifugation can isolate detergent-resistant membrane fractions enriched in sterols and sphingolipids, allowing analysis of the distribution of proteins between raft and non-raft fractions.

  • Fluorescence microscopy: Expression of fluorescently tagged proteins in wild-type versus hmg1 mutant backgrounds can visualize changes in membrane localization patterns. Techniques like FRET (Fluorescence Resonance Energy Transfer) can assess protein-protein or protein-lipid interactions at membranes.

These methods collectively provide a toolkit for investigating how HMG1-dependent membrane composition affects protein localization and function, revealing connections between metabolism and cellular organization.

What are the key considerations for expressing and purifying recombinant Arabidopsis HMG1?

The expression and purification of recombinant Arabidopsis HMG1 presents several challenges:

  • Expression system selection:

    • Yeast expression: Successful expression of Arabidopsis HMG1 has been achieved using the yeast GAL1 promoter in S. cerevisiae strains lacking endogenous HMG-CoA reductase activity . This system allows functional testing through complementation.

    • E. coli expression: While potentially higher-yielding, bacterial expression may require optimization of codon usage and consideration of membrane domain folding.

  • Construct design considerations:

    • Full-length vs. truncated protein: The membrane-spanning N-terminal domain can complicate expression and purification. Some studies may benefit from expressing only the catalytic C-terminal domain.

    • Fusion tags: Addition of affinity tags (His6, GST, MBP) can facilitate purification but may affect enzyme activity and should be validated.

    • Optimal promoter selection: For yeast expression, GAL1 has been successfully used , while T7 or similar promoters are typical for E. coli systems.

  • Solubilization strategies:

    • Detergent selection: As HMG1 is a membrane protein, appropriate detergents are needed for extraction and maintaining solubility. Triton X-100 has been used successfully at 0.5% concentration .

    • Membrane fraction preparation: Careful separation of membrane fractions may improve yield of active enzyme.

  • Activity considerations:

    • Cofactor requirements: Ensure presence of NADPH for activity assays.

    • Substrate availability: Commercial HMG-CoA or synthesis of HMG-CoA from HMG and CoA using HMG-CoA synthase.

    • Storage conditions: Glycerol addition and low-temperature storage to maintain activity.

  • Validation methods:

    • Enzymatic activity measurement: Spectrophotometric monitoring of NADPH oxidation.

    • Yeast complementation: Functional validation through growth rescue of HMG-CoA reductase-deficient yeast.

    • Western blotting: Confirmation of protein expression using specific antibodies.

How can researchers effectively study the cross-talk between isoprenoid biosynthesis and microRNA pathways?

Investigating the connection between isoprenoid biosynthesis and microRNA function requires multidisciplinary approaches:

  • Genetic tools and reporters:

    • miRNA activity reporters: Utilize GFP reporters with miRNA target sites (e.g., GFP171.1 containing a miR171 target site) to visualize miRNA activity in vivo .

    • Control reporters: Include non-targeted versions (e.g., GFPno miR) to distinguish between general and miRNA-specific effects .

    • Mutant combinations: Create double mutants between isoprenoid pathway and miRNA pathway components to identify genetic interactions.

  • Pharmacological approaches:

    • HMG1 inhibitors: Apply lovastatin or other specific inhibitors at varying concentrations to modulate isoprenoid biosynthesis while monitoring miRNA function .

    • Sterol supplementation: Rescue experiments with exogenous sterols can confirm specificity of observed effects to sterol depletion.

    • Dose-response analysis: Establish correlation between degree of isoprenoid pathway inhibition and miRNA activity defects.

  • Membrane biology techniques:

    • Subcellular fractionation: Separate membrane and soluble fractions to quantify membrane association of miRNA machinery components like AGO1 .

    • Membrane extraction protocols: Use detergents, high salt, or alkaline conditions to determine nature of protein-membrane interactions .

    • Lipid raft isolation: Characterize the distribution of miRNA components in sterol-rich membrane microdomains.

  • Quantitative approaches:

    • Sterol profiling: Quantify specific sterol species by gas chromatography to correlate with miRNA activity .

    • MiRNA target quantification: Use qRT-PCR and western blotting to measure levels of miRNA targets (e.g., CSD2, SCL6-IV) as readouts of miRNA activity .

    • Proteomic analysis: Identify changes in membrane-associated proteins under conditions of altered isoprenoid metabolism.

  • Imaging methods:

    • Subcellular localization: Track fluorescently-tagged AGO1 or other miRNA components in wild-type versus hmg1 mutant backgrounds.

    • Co-localization analysis: Determine whether miRNA machinery components co-localize with specific membrane compartments.

This multifaceted approach can help unravel the complex relationship between metabolic and regulatory pathways in plants.

What are the key challenges in interpreting phenotypes of hmg1 mutants?

Interpreting phenotypes of hmg1 mutants presents several analytical challenges:

  • Pathway redundancy:

    • HMG1 and HMG2 redundancy: Arabidopsis contains two HMG-CoA reductase genes (HMG1 and HMG2) with overlapping functions. Complete knockout of both is male gametophytic-lethal , complicating analysis of null mutations.

    • Alternative isoprenoid pathways: Plants possess both the mevalonate (MVA) pathway and the methylerythritol phosphate (MEP) pathway for isoprenoid biosynthesis, with some cross-talk between them.

  • Phenotypic complexity:

    • Pleiotropic effects: The hmg1 mutant shows diverse phenotypes affecting growth, development, fertility, and stress responses , making it challenging to distinguish primary from secondary effects.

    • Tissue-specific manifestations: Different tissues may show varying sensitivity to HMG1 deficiency, as seen in the differential effects on leaves versus inflorescences under microgravity .

    • Environmental influences: Phenotypes may be conditional on environmental factors, as demonstrated by the striking gravity-dependent phenotypes of hmg1 mutants .

  • Distinguishing direct vs. indirect effects:

    • Sterol-dependent vs. independent functions: Determining whether a phenotype results directly from sterol deficiency requires rescue experiments with pathway intermediates like squalene .

    • Hormone involvement: Several plant hormones derive from isoprenoid precursors, so hmg1 phenotypes may partly reflect hormone imbalances.

    • Membrane effects: Changes in membrane properties due to altered sterol content can affect multiple cellular processes, including protein localization and trafficking .

  • Technical considerations:

    • Allelic differences: Different hmg1 alleles may show distinct phenotypes based on the nature and position of the mutation. For example, the mad3 (R458H) mutation results in partial loss of function with different effects than complete knockout.

    • Quantitative assessments: Precise quantification of metabolites, growth parameters, and gene expression is essential for accurate phenotypic characterization.

    • Statistical analysis: Given the variability often observed in plant phenotypes, robust statistical approaches are needed to establish significant differences.

  • Recommended approaches:

    • Multiple alleles: Compare different hmg1 alleles to identify consistent phenotypes.

    • Rescue experiments: Use genetic complementation and feeding studies to confirm specificity.

    • Combinatorial genetics: Analyze double mutants with other pathway components.

    • Detailed time-course studies: Track phenotype development to identify primary defects.

    • Multi-omics integration: Combine transcriptomic, proteomic, and metabolomic analyses to build comprehensive models of HMG1 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.