Recombinant Arabidopsis thaliana 3-hydroxyacyl-CoA dehydratase PASTICCINO 2 (PAS2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana 3-Hydroxyacyl-CoA Dehydratase PASTICCINO 2 (PAS2)

Recombinant Arabidopsis thaliana 3-hydroxyacyl-CoA dehydratase PASTICCINO 2 (PAS2) is a crucial enzyme involved in the elongation of very-long-chain fatty acids (VLCFAs) in plants. VLCFAs are essential components of various lipids, including cuticular waxes, seed triacylglycerols, and complex sphingolipids. PAS2 plays a pivotal role in the third step of the VLCFA elongation cycle, catalyzing the dehydration of 3-hydroxyacyl-CoA intermediates to form trans-2-enoyl-CoAs .

Function and Localization of PAS2

PAS2 is localized in the endoplasmic reticulum (ER) of plant cells, where it interacts with other components of the fatty acid elongase complex, such as the enoyl-CoA reductase CER10 . This interaction is crucial for the efficient elongation of fatty acids. The enzyme's activity is essential for maintaining VLCFA homeostasis, which is vital for plant development and lipid metabolism .

Research Findings and Complementation Studies

Studies have shown that PAS2 can complement the yeast phs1 mutant, which lacks the 3-hydroxyacyl-CoA dehydratase activity necessary for VLCFA synthesis. Conversely, the expression of yeast PHS1 in Arabidopsis can rescue developmental defects in the pas2-1 mutant, highlighting the functional exchangeability of these enzymes . The pas2-1 mutant exhibits reduced VLCFA levels in various lipids and accumulates 3-hydroxyacyl-CoA intermediates, indicating premature termination of fatty acid elongation .

Impact of PAS2 on Plant Development

Complete loss of PAS2 function is embryo lethal, underscoring its critical role in plant development . Ectopic expression of PHS1 in Arabidopsis leads to enhanced VLCFA levels but also causes severe developmental defects, suggesting that precise regulation of VLCFA synthesis is essential for normal plant growth .

Comparison with Other 3-Hydroxyacyl-CoA Dehydratases

In mammals, 3-hydroxyacyl-CoA dehydratases like HACD1 and HACD2 exhibit redundant activities in fatty acid elongation pathways, with HACD2 being more active . Unlike PAS2, which is specific to plants, these mammalian enzymes are involved in a broader range of fatty acid elongation processes.

Table 1: Key Features of PAS2 and Related Enzymes

EnzymeLocalizationFunctionOrganism
PAS2Endoplasmic Reticulum3-Hydroxyacyl-CoA dehydratase in VLCFA elongationArabidopsis
PHS1Endoplasmic Reticulum3-Hydroxyacyl-CoA dehydratase in VLCFA elongationYeast
HACD1/PTPLAEndoplasmic Reticulum3-Hydroxyacyl-CoA dehydratase in FA elongationMammals
HACD2/PTPLBEndoplasmic Reticulum3-Hydroxyacyl-CoA dehydratase in FA elongationMammals

Table 2: Effects of PAS2 Mutations on Lipid Composition

Lipid FractionEffect in pas2-1 Mutant
Cuticular WaxesReduced VLCFA content
Seed TriacylglycerolsReduced VLCFA content
Complex SphingolipidsReduced VLCFA content, increased 16:0 ceramide
GlucosylceramideAlmost complete absence of VLCFAs
Glycosyl-inositol-phosphoceramide (GIPC)Small reduction in VLCFAs

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PAS2; PEP; At5g10480; F12B17.170; Very-long-chain; 3R-3-hydroxyacyl-CoA dehydratase PASTICCINO 2; 3-hydroxyacyl-CoA dehydratase PASTICCINO 2; AtPAS2; HACD; HCD; Protein PEPINO; Protein tyrosine phosphatase-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-221
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PAS2
Target Protein Sequence
MAGFLSVVRRVYLTLYNWIVFAGWAQVLYLAITTLKETGYENVYDAIEKPLQLAQTAAVL EILHGLVGLVRSPVSATLPQIGSRLFLTWGILYSFPEVRSHFLVTSLVISWSITEIIRYS FFGFKEALGFAPSWHLWLRYSSFLLLYPTGITSEVGLIYLALPHIKTSEMYSVRMPNILN FSFDFFYATILVLAIYVPGSPHMYRYMLGQRKRALSKSKRE
Uniprot No.

Target Background

Function

Recombinant Arabidopsis thaliana 3-hydroxyacyl-CoA dehydratase PASTICCINO 2 (PAS2) catalyzes the third step in the four-step long-chain fatty acid elongation cycle. This endoplasmic reticulum-bound enzyme facilitates the addition of two carbons to long- and very long-chain fatty acids (VLCFAs) per cycle. Specifically, PAS2 catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate to trans-2,3-enoyl-CoA. This process contributes to the production of VLCFAs of varying chain lengths, which serve as precursors for membrane lipids and lipid mediators, and are involved in numerous biological processes. PAS2 may also function as an anti-phosphatase, preventing CDKA-1 dephosphorylation and activation, thereby playing a role in hormonal control of cell division and differentiation. It is implicated in the regulation of proliferation in both meristematic and non-meristematic cells, functioning as a negative regulator of the cell cycle.

Gene References Into Functions
  1. PAS2 is an integral membrane protein with cytosolic N- and C-termini. PMID: 20300944
  2. Cell division and differentiation are regulated by the interaction between CDKA;1 and the antiphosphatase PAS2. PMID: 16698944
  3. 3-hydroxy-acyl-CoA dehydratase PASTICCINO2 is crucial for VLCFA synthesis. Maintaining PAS2-derived VLCFA homeostasis is essential for specific developmental processes. PMID: 18799749
Database Links

KEGG: ath:AT5G10480

STRING: 3702.AT5G10480.3

UniGene: At.22730

Protein Families
Very long-chain fatty acids dehydratase HACD family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cytoplasm. Nucleus.
Tissue Specificity
High expression in young seedlings, roots, root tips, flowers and young siliques. Lower levels in leaves and stems.

Q&A

What is the molecular function of PAS2 in Arabidopsis thaliana?

PAS2 is a protein tyrosine phosphatase-like (PTPL) protein characterized by a mutated catalytic site. Despite lacking phosphatase activity, it functions as an antiphosphatase by binding to phosphorylated substrates, particularly cyclin-dependent kinase CDKA;1 when phosphorylated on tyrosine residues . This binding prevents the dephosphorylation of CDKA;1, thereby inhibiting its kinase activity .

Additionally, PAS2 possesses acyl-CoA dehydratase activity based on complementation studies in yeast mutants . It interacts with CER10, a component of the microsomal fatty acid elongase complex, suggesting involvement in the synthesis of very long chain fatty acids (VLCFAs) . This dual functionality makes PAS2 a crucial regulator at the intersection of cell division and lipid metabolism pathways.

How does PAS2 interact with cell cycle regulation?

PAS2 specifically interacts with CDKA;1 only in its phosphorylated form, preventing dephosphorylation . The interaction particularly involves the phosphorylated regulatory Tyr-15 residue of CDKA;1 . Through this mechanism, PAS2 functions as a negative regulator of cell division:

  • In dividing cells, PAS2 interacts transiently or at low levels with phosphorylated CDKA;1, allowing controlled cell proliferation

  • Upon cell differentiation, this interaction appears to increase and stabilize, maintaining CDKA;1 in its inactive phosphorylated state

  • Loss of PAS2 function results in dephosphorylated CDKA;1 and upregulated kinase activity, promoting cell division

  • Overexpression of PAS2 slows down cell division in suspension cultures at the G2-to-M transition and early mitosis

This regulatory role explains why PAS2 overexpression inhibits Arabidopsis seedling growth and why the protein is essential for normal plant development .

What phenotypic effects are observed with PAS2 manipulation?

Alterations in PAS2 expression produce distinct developmental phenotypes:

Table 1: Effects of PAS2 Manipulation on Arabidopsis Development

PAS2 StatusPhenotypic EffectsMolecular Consequences
Wild-typeNormal developmentBalanced CDKA;1 phosphorylation
Knockout (pas2 null)LethalUnknown (essential gene)
Weak allele (reduced expression)Developmental abnormalitiesReduced PAS2-CDKA;1 interaction
OverexpressionSlowed growth, stunted phenotypeIncreased CDKA;1 phosphorylation
OverexpressionSmaller cotyledonsReduced cell number
OverexpressionAccelerated cotyledon senescenceUnknown
OverexpressionAltered first leaf developmentInhibited cell division

Plants overexpressing PAS2 show slowed growth and a stunted phenotype with smaller cotyledons compared to wild-type plants . These cotyledons have a similar number of epidermal cells as wild-type, suggesting that the smaller size results from a reduced number of cells rather than reduced cell size . Additionally, cotyledon senescence appears accelerated in these plants .

First leaf development is often altered in PAS2-overexpressing plants, with first leaves either absent or showing delayed growth with primordia-like shapes or reduced leaf blades . These phenotypes underscore PAS2's importance in regulating the balance between cell division and differentiation during plant development.

What is the subcellular localization pattern of PAS2?

PAS2 exhibits dynamic subcellular localization that correlates with cell differentiation status:

Table 2: PAS2 Localization Patterns in Different Cell Types

Cell TypeDevelopmental StagePAS2 LocalizationAssociated Function
Root meristematic cellsDividingCytoplasmic, excluded from nucleusCell division regulation
Root elongation zoneElongatingCytoplasmic, excluded from nucleusCell elongation
Differentiated root cellsDifferentiatedCytoplasmic and nuclearMaintenance of differentiated state
Root hairsDifferentiatedCytoplasmic and nuclearMaintenance of differentiated state
BY-2 cells (non-dividing)InterphaseMainly cytoplasmic with perinuclear accumulationCell cycle regulation
BY-2 cells (mitotic)MetaphaseAssociated with chromosomes at distal sideMitotic progression
BY-2 cells (mitotic)AnaphaseAssociated with chromosomes at distal sideMitotic progression
BY-2 cells (mitotic)TelophaseAssociated with chromosomes at distal sideMitotic progression

In actively dividing cells like those in the root meristem and elongation zone, PAS2 is predominantly localized in the cytoplasm and excluded from the nucleus . Upon cell differentiation, PAS2 relocates and shows significant nuclear accumulation, as observed in differentiated root cells and root hairs .

During mitosis, PAS2 associates tightly with chromosomes, capping their distal sides during metaphase, anaphase, and late telophase . This dynamic localization pattern suggests distinct roles for PAS2 in dividing versus differentiated cells, supporting its function at the interface of cell division and differentiation.

What experimental approaches are effective for studying the phosphorylation-dependent interactions of PAS2 with CDKs?

Investigating the phosphorylation-dependent interactions between PAS2 and CDKs requires several complementary techniques:

In vitro binding assays:

  • Express and purify recombinant PAS2:His and CDKA;1:MBP (maltose binding protein) fusion proteins

  • Phosphorylate CDKA;1:MBP using Src Tyr kinase in vitro

  • Verify phosphorylation using radioactive incorporation of γ-32P-ATP and Western blot with anti-phosphotyrosine antibodies

  • Load both phosphorylated and unphosphorylated CDKA;1:MBP onto a PAS2 column

  • Analyze bound proteins by Western blotting

Affinity purification from plant extracts:

  • Generate PAS2 affinity columns using purified recombinant PAS2

  • Load Arabidopsis cell culture extracts onto the columns

  • Analyze retained proteins by Western blotting with anti-CDKA;1 antibodies

  • Verify the phosphorylation status of bound CDKA;1 using anti-phosphotyrosine antibodies

p10 CKS1At affinity purification:

  • Use p10 CKS1At columns to purify active CDKA;1 complexes from plant extracts

  • Detect PAS2 in the purified complexes by Western blotting with anti-PAS2 antibodies

  • Compare PAS2 levels in wild-type versus pas2 mutant backgrounds

These approaches have revealed that PAS2 specifically binds to the phosphorylated form of CDKA;1, with Tyr-15 phosphorylation playing a critical role in this interaction .

How can researchers effectively produce and characterize recombinant PAS2?

Successful production and characterization of recombinant PAS2 involves:

Expression systems:

  • E. coli: Use BL21(DE3) strains for expression of His-tagged PAS2

  • Consider lower induction temperatures (16-20°C) to enhance proper folding

  • Purify using Ni-NTA affinity chromatography followed by size exclusion chromatography

Functional validation:

  • Assess binding to phosphorylated CDKA;1 using the techniques described above

  • Verify that the recombinant protein retains the ability to bind phosphorylated substrates despite lacking phosphatase activity

  • Confirm functionality by testing whether the recombinant protein can complement pas2 mutants

Characterization approaches:

  • Verify the absence of phosphatase activity using standard phosphatase assays with p-nitrophenyl phosphate or phosphopeptide substrates

  • Test binding affinity to various phosphorylated proteins using surface plasmon resonance or isothermal titration calorimetry

  • Analyze structural features using circular dichroism spectroscopy or X-ray crystallography

When producing recombinant PAS2, it's important to recognize that while it lacks phosphatase activity, it retains the ability to bind phosphorylated substrates . This characteristic must be preserved during the recombinant protein production process.

How does the absence of phosphatase activity in PAS2 influence experimental design?

The lack of phosphatase activity in PAS2, despite its structural similarity to protein tyrosine phosphatases, necessitates specialized experimental approaches:

Binding assays instead of enzyme kinetics:

  • Focus on substrate binding rather than catalytic activity

  • Design experiments to measure binding affinity to phosphorylated proteins

  • Compare binding to phosphorylated versus non-phosphorylated forms of the same protein

Competitive inhibition assays:

  • Test if PAS2 can inhibit dephosphorylation of CDKA;1 by bona fide phosphatases

  • Determine the protective effect of PAS2 on phosphorylated substrates

  • Design time-course experiments to measure phosphorylation stability in the presence/absence of PAS2

Phosphoproteomic analyses:

  • Compare phosphoproteomes of wild-type and pas2 mutant plants

  • Focus specifically on tyrosine phosphorylation sites

  • Identify additional potential substrates beyond CDKA;1

In vivo phosphorylation monitoring:

  • Develop phospho-specific antibodies against CDKA;1-pY15

  • Use phospho-specific Western blotting to track CDKA;1 phosphorylation status

  • Implement FRET-based biosensors to monitor CDKA;1 phosphorylation in real-time

These specialized approaches accommodate PAS2's unusual biochemical nature as a protein that binds but does not dephosphorylate its substrates .

What statistical methods are appropriate for analyzing PAS2 experimental data?

When analyzing data from PAS2 experiments, appropriate statistical methods include:

For binding studies:

  • Non-linear regression analysis for binding curves

  • Calculation of Kd values to quantify binding affinity

  • Statistical comparison of binding parameters between wild-type and mutant proteins

  • ANOVA with post-hoc tests for comparing multiple conditions

For phenotypic analyses:

  • Student's t-test or Mann-Whitney U test for comparing two genotypes

  • ANOVA for comparing multiple genotypes or treatments

  • Chi-square tests for categorical phenotypic data

  • Correlation analyses to relate molecular changes to phenotypic outcomes

For localization studies:

  • Quantification of nuclear/cytoplasmic ratio using fluorescence intensity measurements

  • Statistical comparison of localization patterns across cell types and developmental stages

  • Co-localization coefficient calculations (Pearson's, Manders')

Sample size and statistical power:

  • Power analysis to determine appropriate sample sizes (n≥30 for most parametric tests)

  • Data analysis should be performed using standard statistical software such as SAS version 9.4

Experimental designs should include appropriate controls and sufficient biological replicates to ensure robust statistical analysis and reproducible results.

What approaches can distinguish between PAS2's dual roles in cell cycle regulation and fatty acid metabolism?

Investigating PAS2's dual functions requires integrated approaches:

Separation-of-function mutations:

  • Generate targeted mutations in PAS2 that specifically disrupt:

    • Phosphoprotein binding (affecting cell cycle regulation)

    • Acyl-CoA dehydratase activity (affecting VLCFA synthesis)

  • Perform complementation studies with these variants in pas2 mutants

  • Assess if distinct phenotypes can be attributed to each function

Temporal and tissue-specific manipulation:

  • Use inducible or tissue-specific promoters to express PAS2

  • Implement CRISPR-based approaches for conditional knockout/knockdown

  • Analyze effects on cell division versus lipid composition

  • Determine if one function precedes or depends on the other

Correlation analyses:

  • Monitor CDKA;1 phosphorylation status and VLCFA levels simultaneously

  • Establish temporal relationships between changes in cell cycle regulation and lipid composition

  • Develop mathematical models to explain how these functions may be coordinated

Multi-omics integration:

  • Combine transcriptomics, proteomics, phosphoproteomics, and lipidomics

  • Implement statistical approaches to correlate changes across datasets

  • Use systems biology approaches to predict emergent properties from dual functionality

Table 3: Experimental Approaches for Distinguishing PAS2 Functions

ApproachApplicationAdvantagesLimitations
Domain-specific mutationsSeparate cell cycle vs. lipid metabolism rolesDirect causalityMay affect protein stability
Tissue-specific expressionIdentify context-dependent functionsIn vivo relevanceTechnical complexity
Metabolite supplementationBypass VLCFA synthesis defectsTests function independenceMay have off-target effects
Synchronized cell culturesTemporal separation of functionsClear cell cycle contextArtificial conditions
Phospho-mimetic CDKA;1Bypass PAS2 cell cycle functionSpecific to one pathwayMay not fully recapitulate function

These approaches can help disentangle PAS2's seemingly disparate functions and potentially reveal how these functions are integrated to coordinate cell division and differentiation with appropriate membrane lipid composition during plant development.

What are the optimal conditions for expressing recombinant PAS2 in heterologous systems?

Recombinant PAS2 expression requires careful optimization:

E. coli expression:

  • Strain selection: BL21(DE3) for high expression; Rosetta for rare codon optimization

  • Vector choice: pET series with T7 promoter for controlled induction

  • Induction conditions: 0.1-0.5 mM IPTG at 16-18°C for 16-18 hours to enhance solubility

  • Lysis buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM DTT, protease inhibitors

  • Purification: Ni-NTA affinity chromatography with imidazole gradient elution

Yeast expression:

  • Suitable for functional complementation studies

  • Can verify acyl-CoA dehydratase activity in appropriate mutant backgrounds

  • Allows study of PAS2 function in a eukaryotic context

Plant cell cultures:

  • BY-2 tobacco cell lines for stable expression

  • Arabidopsis cell suspension cultures for native context

  • Visualization with fluorescent protein fusions

When designing constructs, it's important to verify that recombinant proteins retain functionality through complementation assays in appropriate mutant backgrounds . For PAS2:GFP fusions, verification should include the ability to bind phosphorylated CDKA;1 and to complement the pas2 mutant phenotype.

How can researchers effectively analyze PAS2 interactions with CDKA;1 in vivo?

Analyzing PAS2-CDKA;1 interactions in living plant cells requires specialized approaches:

Co-immunoprecipitation from plant tissues:

  • Develop specific antibodies against PAS2 and CDKA;1

  • Extract proteins under conditions that preserve interactions

  • Immunoprecipitate CDKA;1 and detect PAS2, or vice versa

  • Include phosphatase inhibitors to maintain phosphorylation status

Bimolecular Fluorescence Complementation (BiFC):

  • Generate fusion proteins with split fluorescent protein fragments

  • Express in plant cells to visualize interaction sites in vivo

  • Monitor interaction dynamics during cell cycle progression

  • Compare interaction in dividing versus differentiated cells

Förster Resonance Energy Transfer (FRET):

  • Create PAS2-CFP and CDKA;1-YFP fusions

  • Measure FRET efficiency to quantify interaction strength

  • Perform acceptor photobleaching to confirm specific interaction

  • Use FRET sensors to monitor CDKA;1 phosphorylation status

Proximity Labeling:

  • Fuse PAS2 to BioID or APEX2 enzymatic tags

  • Identify proteins in close proximity to PAS2 in living cells

  • Compare interactomes in different cell types and conditions

  • Validate interactions using orthogonal methods

These approaches can reveal the dynamics of PAS2-CDKA;1 interactions throughout development and in response to various stimuli, providing insight into how PAS2 regulation contributes to the balance between cell division and differentiation.

What techniques are most effective for studying PAS2 localization changes during differentiation?

Multiple complementary approaches can be employed to analyze PAS2's dynamic subcellular localization:

Live cell imaging with fluorescent protein fusions:

  • Generate functional PAS2:GFP fusions verified by complementation

  • Use confocal microscopy for high-resolution imaging

  • Employ time-lapse imaging to track localization changes during:

    • Cell cycle progression

    • Cell differentiation

    • Response to stimuli

Co-localization studies:

  • Combine PAS2:GFP with nuclear, cytoplasmic, and chromatin markers

  • Calculate co-localization coefficients (Pearson's, Manders')

  • Perform line-scan analysis across cellular compartments

Cell fractionation and biochemical analyses:

  • Isolate subcellular fractions (nuclear, cytoplasmic, membrane)

  • Detect PAS2 in different fractions via Western blotting

  • Compare localization across developmental stages and tissues

Inducible expression systems:

  • Use dexamethasone or estradiol-inducible promoters

  • Track localization changes from early expression to steady state

  • Analyze translocation dynamics during cell differentiation

These approaches have revealed that PAS2 exhibits distinct localization patterns: cytoplasmic localization in dividing cells, nuclear localization upon differentiation, and chromosome association during mitosis , suggesting differential functions based on subcellular localization.

How should researchers design experiments to study the effect of PAS2 overexpression?

Designing robust experiments to study PAS2 overexpression effects requires:

Construct design:

  • Generate constructs with constitutive (35S) and inducible promoters

  • Create both untagged PAS2 and fluorescent protein fusions

  • Verify functionality through complementation of pas2 mutants

  • Include appropriate controls (empty vector, unrelated protein overexpression)

Transgenic line selection:

  • Generate multiple independent transgenic lines

  • Quantify PAS2 expression levels by RT-PCR relative to endogenous controls (e.g., EF1α)

  • Select lines with varying expression levels to establish dose-response relationships

  • Ensure stable expression across generations

Phenotypic analyses:

  • Compare plant growth parameters (height, leaf size, developmental timing)

  • Measure cell number and size in affected organs

  • Assess cotyledon senescence markers

  • Quantify root growth and lateral root development

Molecular analyses:

  • Monitor CDKA;1 phosphorylation status

  • Measure cell cycle marker expression

  • Analyze VLCFA content and composition

  • Perform transcriptomic analysis to identify affected pathways

Statistical considerations:

  • Include sufficient biological replicates (n≥30 per genotype)

  • Perform appropriate statistical tests for data analysis

  • Establish clear criteria for phenotypic classification

  • Control for environmental variables

Studies have shown that PAS2 overexpression leads to slowed growth, stunted phenotype, smaller cotyledons, accelerated cotyledon senescence, and altered leaf development , providing a framework for expected phenotypes in overexpression studies.

What approaches are recommended for studying PAS2 function at different developmental stages?

To study PAS2 function across development:

Stage-specific expression analysis:

  • Use RNA-seq or RT-qPCR to profile PAS2 expression across tissues and developmental stages

  • Implement in situ hybridization to visualize spatial expression patterns

  • Create PAS2 promoter:reporter fusions to monitor expression dynamics

Conditional genetic manipulation:

  • Employ inducible promoter systems (e.g., dexamethasone, estradiol)

  • Utilize tissue-specific promoters for targeted expression/silencing

  • Implement CRISPR-based approaches for conditional knockout

Live imaging of developmental processes:

  • Generate stable lines expressing PAS2:GFP under native promoter

  • Track protein localization throughout development using confocal microscopy

  • Correlate localization changes with developmental transitions

Developmental phenotyping:

  • Establish clear staging criteria for consistent comparisons

  • Create detailed timelines of developmental events in wild-type vs. mutant backgrounds

  • Quantify cell division patterns using appropriate cell cycle markers

  • Analyze tissue-specific effects on differentiation

Integration with developmental markers:

  • Combine PAS2 manipulation with established developmental marker lines

  • Correlate PAS2 function with known developmental regulators

  • Determine epistatic relationships through genetic interaction studies

These approaches can reveal how PAS2 contributes to developmental processes, particularly at transition points between cell proliferation and differentiation, such as during embryo development where PAS2 is strongly expressed in the apical zone of the globular embryo prior to cotyledon initiation .

How can researchers address the challenge of PAS2 functional redundancy?

Addressing potential functional redundancy requires:

Comprehensive phylogenetic analysis:

  • Identify all PTPL family members in Arabidopsis

  • Determine expression patterns and potential functional overlap

  • Construct phylogenetic trees to identify closest homologs

Multiple gene knockdown/knockout:

  • Generate higher-order mutants targeting related PTPL genes

  • Use CRISPR/Cas9 for simultaneous targeting of multiple genes

  • Employ artificial microRNAs for tissue-specific knockdown

Domain-specific functional analysis:

  • Identify unique versus conserved domains across PTPL proteins

  • Create chimeric proteins to test domain functionality

  • Perform domain-swapping experiments between family members

Biochemical complementation:

  • Test if other PTPL proteins can bind phosphorylated CDKA;1

  • Determine if other family members show subcellular localization patterns similar to PAS2

  • Assess if other PTPL proteins can complement pas2 mutants

Transcriptome analysis:

  • Compare expression changes in single versus multiple PTPL mutants

  • Identify compensatory transcriptional responses

  • Determine common and unique downstream targets

These approaches can help distinguish between unique and redundant functions of PAS2, providing a more complete understanding of PTPL protein roles in plant development.

What controls should be included when studying PAS2 phosphoprotein interactions?

Robust controls for studying PAS2-phosphoprotein interactions include:

Phosphorylation controls:

  • Compare binding to phosphorylated versus unphosphorylated substrates

  • Include phosphatase-treated samples to confirm phosphorylation dependency

  • Use phosphomimetic (Y→D/E) and phospho-dead (Y→F) mutations of interaction partners

Protein specificity controls:

  • Test binding to unrelated phosphorylated proteins

  • Include structurally similar but functionally distinct PTPL proteins

  • Use an unrelated protein with a similar size/charge as a negative control

Binding assay controls:

  • Empty column controls for affinity purification experiments

  • Include input sample in all binding experiments

  • Perform competition assays with phosphopeptides

Functional validation:

  • Correlate binding affinity with functional outcomes

  • Test if mutations that disrupt binding affect biological function

  • Verify that recombinant proteins maintain native conformation

Technical controls:

  • Include technical replicates for all binding assays

  • Perform reverse experiments (e.g., if PAS2 pulls down CDKA;1, verify CDKA;1 pulls down PAS2)

  • Use multiple detection methods to confirm interactions

These controls ensure that observed interactions are specific, phosphorylation-dependent, and biologically relevant.

How can researchers optimize PAS2:GFP fusion proteins for localization studies?

Optimizing PAS2:GFP fusions requires attention to:

Fusion design:

  • Test both N-terminal and C-terminal GFP fusions

  • Include flexible linkers between PAS2 and GFP

  • Consider using smaller fluorescent tags (e.g., mNeonGreen) if GFP causes artifacts

Functional validation:

  • Verify complementation of pas2 mutants with PAS2:GFP constructs

  • Confirm ability to bind phosphorylated CDKA;1

  • Test if fusion proteins produce expected phenotypes when overexpressed

Expression level optimization:

  • Use native promoter for physiological expression levels

  • If using overexpression, select lines with moderate expression

  • Consider inducible systems to control expression timing and level

Imaging parameters:

  • Optimize laser power to minimize photobleaching and phototoxicity

  • Use appropriate controls for autofluorescence

  • Implement deconvolution for improved resolution

  • Consider advanced techniques like FRAP to study protein dynamics

Fixation protocols (if needed):

  • Test multiple fixation methods to preserve native localization

  • Validate fixed samples against live imaging results

  • Include appropriate controls to detect fixation artifacts

Studies using PAS2:GFP have successfully revealed dynamic localization patterns, showing cytoplasmic localization in dividing cells, nuclear localization in differentiated cells, and chromosome association during mitosis , demonstrating the utility of well-designed fluorescent fusion proteins.

What strategies can overcome challenges in detecting subtle PAS2-related phenotypes?

Detecting subtle phenotypes requires:

Controlled growth conditions:

  • Maintain strict environmental parameters (light, temperature, humidity)

  • Implement growth chamber conditions rather than greenhouse

  • Use randomized experimental design to control for position effects

  • Grow wild-type and mutant plants side-by-side

Quantitative phenotyping:

  • Develop objective, quantitative metrics for phenotype assessment

  • Use automated image analysis tools for unbiased measurements

  • Implement time-course analyses to capture transient phenotypes

  • Increase sample size to improve statistical power

Genetic background standardization:

  • Backcross mutants multiple generations to ensure clean background

  • Use sibling comparisons whenever possible

  • Generate multiple independent transgenic/mutant lines

Sensitive molecular assays:

  • Develop highly sensitive assays for CDKA;1 phosphorylation status

  • Implement digital PCR for precise gene expression quantification

  • Use phospho-specific antibodies to detect subtle changes in phosphorylation

Integrative phenotyping:

  • Combine morphological, cellular, and molecular phenotyping

  • Correlate multiple phenotypic parameters to identify patterns

  • Use principal component analysis to detect complex phenotypic signatures

These approaches can reveal subtle phenotypes that might be missed with less rigorous methods, particularly important when studying proteins like PAS2 that may have dose-dependent effects or function in multiple pathways.

How can researchers effectively purify intact PAS2 protein complexes from plant tissues?

Purifying intact PAS2 complexes requires:

Optimized extraction conditions:

  • Use gentle extraction buffers (e.g., 50 mM HEPES pH 7.5, 150 mM NaCl, 10% glycerol, 0.1% NP-40)

  • Include phosphatase inhibitors to preserve phosphorylation status

  • Add protease inhibitors to prevent degradation

  • Maintain cold temperature throughout extraction

Affinity purification strategies:

  • Generate transgenic plants expressing tagged PAS2 (e.g., TAP-tag, FLAG, HA)

  • Use antibodies against endogenous PAS2 for immunoprecipitation

  • Consider crosslinking approaches to capture transient interactions

  • Implement two-step purification for increased purity

Validation of complex integrity:

  • Confirm presence of known interactors (e.g., CDKA;1)

  • Verify phosphorylation status of interacting proteins

  • Compare complex composition across tissues and developmental stages

Mass spectrometry analysis:

  • Use quantitative proteomics to identify stoichiometric components

  • Implement phosphoproteomics to map phosphorylation sites

  • Compare complexes from different developmental contexts

  • Validate novel interactions using orthogonal methods

Alternative approaches:

  • Consider proximity labeling (BioID, APEX) for capturing in vivo interactions

  • Use size exclusion chromatography to separate distinct PAS2-containing complexes

  • Implement blue native PAGE to preserve native complex state

These approaches can yield intact PAS2 complexes suitable for functional and structural studies, providing insight into how PAS2 integrates cell division regulation with other cellular processes.

How do current findings on PAS2 contribute to our understanding of plant development?

The characterization of PAS2 has significantly advanced our understanding of several key aspects of plant development:

  • Cell division and differentiation balance: PAS2 functions as an antiphosphatase that regulates CDKA;1 activity, influencing the transition between cell proliferation and differentiation . This mechanism provides insight into how plants coordinate these fundamental processes during development.

  • Dual-function proteins: PAS2's roles in both cell cycle regulation and VLCFA synthesis illustrate how plants integrate distinct cellular processes through multifunctional proteins . This challenges the traditional "one gene-one function" paradigm and demonstrates the complexity of plant developmental networks.

  • Evolutionary conservation: PAS2 is conserved across eukaryotes, from yeast to mammals and plants, suggesting it participates in fundamental cellular processes that have been maintained throughout evolution . The Arabidopsis PAS2 gene can complement yeast lethality, highlighting this functional conservation .

  • Developmental transitions: PAS2's expression during early embryo development marks the onset of cotyledon initiation, coinciding with the transition from radial to bilateral symmetry . This places PAS2 at a critical developmental transition point, potentially coordinating cell division patterns with developmental timing.

  • Subcellular localization dynamics: The movement of PAS2 from the cytoplasm to the nucleus upon cell differentiation provides a model for studying how protein relocalization contributes to developmental transitions .

These findings collectively enhance our understanding of the molecular mechanisms underlying plant development, particularly how cell division, differentiation, and metabolism are coordinated to achieve proper organismal growth and form.

What are the most promising future research directions for PAS2 studies?

Several promising research directions emerge from current PAS2 knowledge:

  • Structural biology approaches: Determining the crystal structure of PAS2 in complex with phosphorylated CDKA;1 would provide molecular insights into how this antiphosphatase functions and could guide the development of tools to manipulate cell division in plants.

  • Systems biology integration: Comprehensive multi-omics approaches combining transcriptomics, proteomics, phosphoproteomics, and lipidomics could reveal how PAS2's dual functions in cell cycle regulation and lipid metabolism are integrated at the systems level.

  • Developmental timing mechanisms: Investigating how PAS2 contributes to developmental timing, particularly during embryogenesis and leaf initiation, could uncover new principles of plant developmental regulation.

  • Single-cell resolution studies: Applying single-cell RNA-seq and spatial transcriptomics to map PAS2 expression and function at cellular resolution could reveal cell-type specific roles and developmental trajectories.

  • Translational applications: Understanding PAS2's role in regulating the balance between cell division and differentiation could potentially be leveraged for agricultural applications, such as manipulating seed size, leaf development, or stress responses.

  • Comparative studies across species: Investigating PAS2 function across diverse plant species could reveal how this conserved protein has been adapted for species-specific developmental programs throughout plant evolution.

  • Interaction with plant hormones: Exploring how PAS2 functions interact with plant hormone signaling pathways, particularly cytokinins and auxins that regulate cell division and differentiation, represents an important area for future research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.