Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 10 (FDH)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipid Metabolism

FDH is epidermis-specific and primarily involved in synthesizing cuticular waxes, which protect plants from water loss and environmental stressors . Key functional insights include:

  • Catalytic Activity: Condenses malonyl-CoA with acyl-CoA substrates to produce 3-oxoacyl-CoA intermediates, initiating VLCFA elongation .

  • Mutant Phenotypes: fdh mutants exhibit organ fusion, reduced trichome formation, and enhanced cell wall permeability due to disrupted wax synthesis .

  • Ortholog Conservation: Functional homologs of FDH regulate wax biosynthesis in diverse species, including alfalfa (MsKCS10) and moss (Physcomitrium patens) .

Enzymatic Regulation and Interactions

  • Substrate Specificity: FDH homologs like KCS1 and KCS6 preferentially elongate C16–C24 acyl-CoA substrates .

  • Regulatory Role: KCS3, a non-catalytic KCS, physically interacts with KCS6 to suppress its activity, highlighting the complex regulation of VLCFA synthesis .

  • Yeast Complementation: Expression of AtKCS10 in yeast restores VLCFA production, confirming its role in fatty acid elongation .

Biotechnological Applications

  • Drought Tolerance: Overexpression of MsKCS10 (alfalfa homolog) increases cuticular wax deposition and enhances drought resistance by reducing nonstomatal water loss .

  • Wax Crystal Morphology: Transgenic plants expressing MsKCS10 develop unique wax structures (e.g., coiled rodlets), altering surface hydrophobicity .

Key Research Implications

  • Wax Homeostasis: FDH-mediated VLCFA synthesis is critical for maintaining cuticle integrity, with disruptions leading to developmental defects .

  • Evolutionary Conservation: The KCS3–KCS6 regulatory module is conserved across land plants, underscoring its ancestral role in lipid metabolism .

  • Agricultural Potential: Engineering KCS10 activity could improve crop resilience to abiotic stresses like drought .

Outstanding Questions

  • Catalytic Mechanism: Structural details of FDH’s active site remain unresolved due to challenges in purifying full-length membrane-associated KCS enzymes .

  • Tissue-Specific Roles: The spatial regulation of FDH in non-epidermal tissues (e.g., roots, seeds) is poorly understood .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we can fulfill specific format requirements. Please indicate your desired format when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple use, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will prioritize the development of specified tag types if provided during order placement.
Synonyms
FDH; EL4; KCS10; At2g26250; T1D16.11; 3-ketoacyl-CoA synthase 10; KCS-10; Protein FIDDLEHEAD; Very long-chain fatty acid condensing enzyme 10; VLCFA condensing enzyme 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-550
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FDH
Target Protein Sequence
MGRSNEQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLIN HAVYLATIPVLVLVFSAEVGSLSREEIWKKLWDYDLATVIGFFGVFVLTACVYFMSRPRS VYLIDFACYKPSDEHKVTKEEFIELARKSGKFDEETLGFKKRILQASGIGDETYVPRSIS SSENITTMKEGREEASTVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVINH YKMRGNILSYNLGGMGCSAGIIAIDLARDMLQSNPNSYAVVVSTEMVGYNWYVGSDKSMV IPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKGLK ISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTSTTTSFSTSATA KTNGIKSSSSDLSKPYIPDYKLAFEHFCFHAASKVVLEELQKNLGLSEENMEASRMTLHR FGNTSSSGIWYELAYMEAKESVRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPTRNNPWV DCINRYPVPL
Uniprot No.

Target Background

Function
This protein contributes to cuticular wax and suberin biosynthesis. It prevents the postgenital fusion of epidermal cells in contact organs, as well as ectopic pollen hydration and germination. This protein is also required during ovule formation. It may regulate an epidermis-specific developmental program during gynoecial ontogeny.
Database Links

KEGG: ath:AT2G26250

STRING: 3702.AT2G26250.1

UniGene: At.47566

Protein Families
Chalcone/stilbene synthases family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Mostly expressed in epidermal cells of floral and vegetative meristems and, to a lower extent, of leaves and coleoptiles, especially in young tissues. Also present in trichomes and phloem. Expressed in siliques, seedlings, flowers and leaves.

Q&A

What is Arabidopsis thaliana 3-ketoacyl-CoA synthase 10 (FDH) and what are its primary functions?

Arabidopsis thaliana 3-ketoacyl-CoA synthase 10 (FDH) belongs to the 3-KETOACYL-COA SYNTHASE (KCS) family. These enzymes catalyze the substrate-specific elongation of very-long-chain fatty acids (VLCFAs), which serve as precursors to membrane lipids and plant cuticular waxes . Unlike some other KCS family members, FDH/KCS10 has unique functions in plant defense and development. Research indicates that FDH plays a significant role in nonhost disease resistance in plants like Nicotiana benthamiana and Arabidopsis thaliana .

The protein contains two domains: an FAE1_typ3_polyketide_synth domain in the N-terminus and an ACP_syn_III domain in the C-terminus . These structural features contribute to its functionality in fatty acid elongation processes and plant defense responses.

How does FDH differ from other members of the KCS family?

FDH/KCS10 differs from other KCS family members in several key aspects:

  • Substrate specificity: Different KCS paralogs show differential preferences towards substrates based on carbon length, saturation, and stereochemistry .

  • Inhibitor sensitivity: KCS family members demonstrate variable sensitivity to K3 herbicides, with FDH showing distinct response patterns compared to other KCS proteins .

  • Defense functions: Unlike some other KCS proteins that primarily function in wax synthesis, FDH has been shown to play important roles in plant defense responses against bacterial pathogens .

  • Cellular localization: While many KCS proteins function in the endoplasmic reticulum for fatty acid elongation, FDH has been observed to localize primarily to mitochondria, with potential targeting to chloroplasts during defense responses .

How does FDH/KCS10 contribute to plant defense mechanisms against bacterial pathogens?

FDH plays a multifaceted role in plant defense mechanisms against bacterial pathogens through several pathways:

  • Activation of defense signaling: FDH is highly upregulated in response to both host and nonhost bacterial pathogens in Arabidopsis . Studies with Atfdh1 mutants demonstrate compromised nonhost resistance, basal resistance, and gene-for-gene resistance, indicating its central role in plant defense responses .

  • Hormone-mediated defense responses: The expression patterns of salicylic acid (SA) and jasmonic acid (JA) marker genes after pathogen infections in Atfdh1 mutants indicate that both SA and JA signaling pathways are involved in the FDH-mediated plant defense response .

  • Organelle coordination: FDH primarily localizes to mitochondria but may also target chloroplasts during defense responses. This dual targeting suggests a potential role in coordinating mitochondria- and chloroplast-mediated defense responses against bacterial pathogens .

  • Early defense response through hydathodes: In vivo studies using reporter constructs driven by the FDH promoter in Arabidopsis thaliana leaves revealed that FDH appears to play an important role in early defense response pathways involving hydathodes (specialized pores in plant leaves) following infection with pathogens like Xanthomonas campestris pv campestris .

What molecular mechanisms determine substrate specificity in FDH/KCS10 compared to other KCS enzymes?

Research into KCS family substrate specificity has identified several key molecular determinants:

  • Critical protein regions: Studies using homology models, site-directed mutants, and chimeric proteins have identified two key regions – helix-4 and position 277 – as major determinants of substrate specificity in KCS enzymes . These findings suggest similar mechanisms may operate in FDH/KCS10.

  • Domain interactions: The N-terminus and C-terminus domains play different roles in substrate binding and catalysis. In some KCS proteins, interactions between the C-terminus of one KCS (like KCS3) and the N-terminus of another (like KCS6) can modulate enzymatic activity . For FDH/KCS10, understanding these domain interactions is crucial for determining its substrate preferences.

  • Heteromeric complex formation: FDH/KCS10 likely participates in protein complexes with other enzymes in the fatty acid elongation pathway. The specific composition of these complexes can influence substrate accessibility and specificity .

A comparative analysis of substrate specificity determinants across the KCS family reveals evolutionary patterns that have shaped the functional diversification of these enzymes, including FDH/KCS10 .

How does FDH/KCS10 expression change during different stress conditions and developmental stages?

FDH expression is dynamically regulated during various stress conditions:

  • Pathogen challenge: FDH expression is drastically increased upon infection with both host and nonhost bacterial pathogens in Arabidopsis . This upregulation is part of the plant's defense response mechanism.

  • Rhizobacterial colonization: FDH promoter activity is rapidly induced in hydathodes of plants colonized by beneficial rhizobacteria like Pseudomonas simiae WCS417, or even when plants are exposed to these bacteria without direct root contact . This suggests a role in systemic defense signaling.

  • Wounding stress: FDH may be involved in response to mechanical wounding, as observed in studies examining FDH-GFP localization following tissue damage .

  • Developmental regulation: Though not extensively characterized in the provided search results, FDH likely shows specific expression patterns during different developmental stages, particularly those involving cuticle and wax formation.

Proteome analyses of wild-type and atfdh1-5 knockout mutants colonized by rhizobacteria have revealed changes in stress-responsive proteins and extrinsic photosystem proteins, suggesting broader metabolic impacts of FDH beyond direct defense responses .

What are the optimal methods for expressing and purifying recombinant FDH/KCS10 protein?

For optimal expression and purification of recombinant FDH/KCS10, researchers should consider the following approaches:

  • Expression system selection: E. coli has been successfully used to express full-length recombinant FDH/KCS10 with N-terminal His-tags . Alternative expression systems might include yeast or insect cells for projects requiring post-translational modifications.

  • Purification protocol:

    • Use metal affinity chromatography (IMAC) for initial purification of His-tagged FDH

    • Consider size exclusion chromatography as a secondary purification step

    • Maintain protein in Tris/PBS-based buffer systems during purification

  • Quality control measures:

    • Confirm purity using SDS-PAGE (should be >90%)

    • Verify protein identity using Western blotting with anti-His antibodies

    • Consider mass spectrometry for definitive identification

  • Storage considerations:

    • Store at -20°C/-80°C upon receipt

    • Aliquot to avoid repeated freeze-thaw cycles

    • For working solutions, store at 4°C for up to one week

What experimental approaches are effective for studying FDH/KCS10 localization and protein-protein interactions?

Several effective experimental approaches have been utilized to study FDH localization and interactions:

  • Subcellular localization:

    • Fluorescent protein fusion constructs (e.g., FDH-GFP) expressed under native promoters for in vivo visualization

    • Confocal laser scanning microscopy for tracking protein localization before and after pathogen challenge

    • Co-visualization with organelle markers for mitochondria and chloroplasts

  • Protein-protein interaction studies:

    • Luciferase Complementation Imaging (LCI) assay for detecting protein interactions in planta

    • Co-immunoprecipitation followed by mass spectrometry to identify interaction partners

    • Yeast two-hybrid screening for identifying novel interacting proteins

  • Domain interaction mapping:

    • Testing interactions between full or truncated versions of proteins (as done with KCS3 and KCS6)

    • Site-directed mutagenesis to identify specific amino acids involved in protein interactions

  • Quantification methods:

    • Firefly & Renilla Luciferase Assay Kit for precise quantification of interaction signals

    • Internal controls (e.g., co-transformation with 35S:RLUC) for normalizing interaction signals

How can researchers generate and validate mutant or transgenic lines to study FDH/KCS10 function?

Researchers can employ several approaches to generate and validate lines for studying FDH function:

  • Generation of mutant/transgenic lines:

    • T-DNA insertion mutants (e.g., atfdh1-5) for loss-of-function studies

    • CRISPR/Cas9 gene editing for precise mutations

    • Overexpression lines using the 35S promoter (e.g., 35S:KCS3-YFP)

    • Promoter-reporter fusions (e.g., pFDH:GUS) for expression pattern studies

    • Complementation lines expressing FDH-GFP under native promoter control

  • Validation approaches:

    • RT-PCR and qRT-PCR to confirm altered transcript levels

    • Western blotting to verify protein expression or absence

    • Phenotypic analysis under both normal and stress conditions

    • Functional complementation tests to confirm the specificity of observed phenotypes

  • Experimental designs for functional analysis:

    • Pathogen challenge assays to assess disease resistance

    • Analysis of cuticular wax composition and content

    • Examination of responses to various abiotic stresses

    • Proteome analysis to identify altered pathways in mutants versus wild-type plants

How should researchers interpret conflicting data regarding FDH/KCS10 localization in different cellular compartments?

Previous studies have reported conflicting results regarding FDH localization, with some suggesting mitochondrial localization and others indicating dual targeting to both mitochondria and chloroplasts. When encountering such contradictions, researchers should:

  • Consider experimental context differences:

    • Examine whether different plant growth conditions or developmental stages were used

    • Determine if experiments were conducted under stress or normal conditions

    • Compare protein tagging approaches (N-terminal vs. C-terminal tags may affect localization)

  • Apply multiple complementary techniques:

    • Combine fluorescent protein fusion studies with subcellular fractionation

    • Use immunogold electron microscopy for higher-resolution localization

    • Employ biochemical assays to confirm functional activity in specific compartments

  • Investigate dynamic localization:

    • Recent evidence suggests that FDH mainly localizes to mitochondria under normal conditions but may associate with chloroplasts during pathogen defense responses

    • Time-course experiments following pathogen challenge can reveal dynamic relocalization patterns

  • Consider protein isoforms and processing:

    • Alternative splicing or post-translational processing might generate different protein variants with distinct localization patterns

    • Examine whether specific experimental conditions might induce alternative isoform expression

The apparent dynamic localization of FDH between mitochondria and chloroplasts suggests a possible role in coordinating defense responses between these organelles, making this an important area for further investigation .

What statistical approaches are most appropriate for analyzing FDH/KCS10 activity data and expression patterns?

When analyzing FDH/KCS10 activity and expression data, researchers should consider:

  • For enzyme activity assays:

    • ANOVA with post-hoc tests (Tukey's HSD) for comparing activity across multiple conditions

    • Michaelis-Menten kinetics analysis to determine Km and Vmax parameters

    • Non-linear regression for analyzing substrate specificity profiles

    • Control for temperature, pH, and substrate availability as confounding variables

  • For gene expression studies:

    • Normalized expression using reference genes (GAPDH, Actin, Ubiquitin) for qRT-PCR data

    • Calculate fold-change using the 2^-ΔΔCt method with appropriate error propagation

    • Time-course expression data may require repeated measures ANOVA or mixed models

    • Consider multiple testing correction (Bonferroni or FDR) when examining multiple genes

  • For correlation analysis:

    • Pearson or Spearman correlation to identify genes with similar expression patterns to FDH

    • Network analysis to identify functional modules involving FDH

    • Principal component analysis to reduce dimensionality in large-scale expression datasets

  • For proteome analysis:

    • Appropriate normalization of spectral counts or ion intensities

    • Volcano plots to visualize significant changes in protein abundance

    • Pathway enrichment analysis to identify biological processes affected by FDH knockout

A correlation analysis of Arabidopsis thaliana gene expression under biotic stress showed that the top correlators of FDH are genes involved in defense responses, providing statistical support for its role in plant immunity .

How can researchers reconcile the dual roles of FDH/KCS10 in both cuticular wax synthesis and pathogen defense?

The dual functionality of FDH/KCS10 in both cuticular wax metabolism and pathogen defense presents an intriguing research question. To reconcile these seemingly distinct roles, researchers should consider:

  • Mechanistic connections:

    • Cuticular waxes serve as physical barriers against pathogens, so alterations in wax composition directly impact defense

    • Fatty acid-derived signals are involved in defense signaling pathways

    • Changes in membrane lipid composition can affect cellular signaling and organelle function during defense responses

  • Regulatory network analysis:

    • Examine transcription factors that regulate both wax biosynthesis and defense genes

    • Investigate whether FDH might serve as a molecular switch between normal development and stress response

    • Analyze whether FDH interacts with different protein partners under different conditions

  • Evolutionary perspective:

    • Consider that dual functionality might represent evolutionary adaptation

    • Compare FDH function across species with different defense strategies

    • Examine whether this dual role is conserved in other plant taxa

  • Experimental approaches to distinguish roles:

    • Use tissue-specific or inducible expression systems to separate developmental and defense functions

    • Employ structure-function studies to identify domains responsible for each function

    • Design experiments that can temporally separate wax synthesis and defense responses

The observed rapid induction of FDH promoter activity in hydathodes following pathogen exposure suggests specific roles in early defense responses , while its involvement in fatty acid elongation complexes indicates contributions to wax synthesis , supporting the notion of context-dependent functional switching.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.