Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 15 (KCS15)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 15 (KCS15) is an enzyme that functions in the elongation of fatty acids . Specifically, KCS15 is involved in the synthesis of very long-chain fatty acids (VLCFAs) . In Arabidopsis thaliana, there are 21 KCS members, which catalyze the first committed step in the elongation of fatty acids, adding two carbons to the acyl chain in each cycle . KCS15 is expressed in the tapetum, a layer of cells in the anther that nourishes developing pollen . It acts redundantly with KCS7 and KCS21 in pollen coat lipid synthesis, which is essential for pollen hydration .

KCS15 is also known by the following names :

  • At3g52160

  • F4F15.270

  • 3-ketoacyl-CoA synthase 15

  • KCS-15

  • Very long-chain fatty acid condensing enzyme 15

  • VLCFA condensing enzyme 15

Protein Production and Availability

Recombinant KCS15 can be produced in various expression systems, including E. coli, yeast, baculovirus, and mammalian cells . The recombinant protein is available with different tags, such as a His-tag, which facilitates purification . KCS15 is available from commercial sources for research purposes .

Table 1: Available Recombinant KCS15 Products

CodeSourceConjugate
CSB-YP886789DOA1YeastN/A
CSB-EP886789DOA1E. coliN/A
CSB-EP886789DOA1-BE. coliAvi-tag Biotinylated (E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology)
CSB-BP886789DOA1BaculovirusN/A
CSB-MP886789DOA1Mammalian cellN/A

Structure and Function

KCS15 is a full-length protein consisting of 451 amino acids . It belongs to the 3-ketoacyl-CoA synthase family of enzymes, which are crucial for the elongation of fatty acids . These enzymes catalyze the condensation reaction that adds two carbons to the growing acyl chain .

Table 2: Protein Information

FeatureDescription
SpeciesArabidopsis thaliana
SourceE. coli
TagHis
Protein LengthFull Length (1-451)
Amino Acid SequenceMEKEATKMVNGGVKSKSPKGSPDFLGYNLRYVKLGYIYLLSLSRTFCFFLPPLLLLFIFV SRFLPILAFPLSTFFILLIYHYLTPSSVFLLDFSCYRPPDHLKITKSDFIELAMKSGNFN ETAIELQRKVLDQSGIGEESYMPRVVFKPGHRVNLRDGREEAAMVIFGAIDELLAATKIN VKHIKILVLNCGVLNTTPSLSAMVINHYKLRHNTESYNLGGMGCSAGVIAIDLAKDLLNA HQGSYALVVSTEIVSFTWYSGNDVALLPPNCFFRMGAAAVMLSSRRIDRWRAKYQLMQLV RTHKGMEDTSYKSIELREDRDGKQGLYVSRDVMEVGRHALKANIATLGRLEPSFEHICVL ASSKKVLDDIHKDLKLTEENMEASRRTLERFGNTSSSSIWYELAYLEHKAKMKRGDRVWQ IGFGSGFKCNSVVWKALKNIDPPRHNNPWNL
PurityGreater than 90% as determined by SDS-PAGE

Role in Fatty Acid Biosynthesis

KCS15 plays a role in fatty acid biosynthesis, particularly in the production of VLCFAs . VLCFAs are essential components of various plant lipids, including cuticular waxes and seed storage lipids . The co-expression of KCS15 with CRC and AP1 suggests its involvement in fatty acid biosynthesis . CRC can bind to the promoter regions of KCS7 and KCS15, indicating that CRC may directly regulate fatty acid biosynthesis .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
KCS15; At3g52160; F4F15.270; 3-ketoacyl-CoA synthase 15; KCS-15; Very long-chain fatty acid condensing enzyme 15; VLCFA condensing enzyme 15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-451
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
KCS15
Target Protein Sequence
MEKEATKMVNGGVKSKSPKGSPDFLGYNLRYVKLGYIYLLSLSRTFCFFLPPLLLLFIFV SRFLPILAFPLSTFFILLIYHYLTPSSVFLLDFSCYRPPDHLKITKSDFIELAMKSGNFN ETAIELQRKVLDQSGIGEESYMPRVVFKPGHRVNLRDGREEAAMVIFGAIDELLAATKIN VKHIKILVLNCGVLNTTPSLSAMVINHYKLRHNTESYNLGGMGCSAGVIAIDLAKDLLNA HQGSYALVVSTEIVSFTWYSGNDVALLPPNCFFRMGAAAVMLSSRRIDRWRAKYQLMQLV RTHKGMEDTSYKSIELREDRDGKQGLYVSRDVMEVGRHALKANIATLGRLEPSFEHICVL ASSKKVLDDIHKDLKLTEENMEASRRTLERFGNTSSSSIWYELAYLEHKAKMKRGDRVWQ IGFGSGFKCNSVVWKALKNIDPPRHNNPWNL
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G52160

STRING: 3702.AT3G52160.1

UniGene: At.35320

Protein Families
Chalcone/stilbene synthases family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in flowers.

Q&A

What is the function of 3-ketoacyl-CoA synthase 15 in Arabidopsis thaliana?

3-ketoacyl-CoA synthase 15 (KCS15) is a member of the KCS enzyme family in Arabidopsis thaliana that catalyzes the initial condensation reaction in the fatty acid elongation (FAE) process. As part of the fatty acid elongase complex, KCS15 contributes to the biosynthesis of very-long-chain fatty acids (VLCFAs), which are essential components of plant cuticular waxes, suberin, and membrane lipids . The KCS family in Arabidopsis consists of 21 identified genes that exhibit varying degrees of substrate specificity and tissue expression patterns, leading to functional specialization and redundancy . While specific functions of KCS15 are still being elucidated, it likely contributes to the diverse array of VLCFAs found in different plant tissues and developmental stages.

How does KCS15 differ structurally and functionally from other KCS family members in Arabidopsis?

KCS15 is one of the 21 KCS enzymes in Arabidopsis that share core catalytic domains but differ in substrate specificity and expression patterns. Structurally, all KCS enzymes contain conserved domains for fatty acid binding and condensation activity, but variations in specific amino acid residues likely influence substrate chain-length preferences and reaction kinetics . Unlike well-characterized members such as KCS1 (involved in wax biosynthesis producing C20-C22 VLCFAs), KCS18/FAE1 (producing seed-specific C20-C22 VLCFAs), or KCS16 (involved in trichome wax production), the precise substrate specificity of KCS15 requires further characterization .

Functional differentiation among KCS enzymes is evidenced by their diverse expression patterns across tissues and in response to environmental stresses. While some KCS genes like KCS1 and KCS16 show mutant phenotypes and have been successfully characterized in heterologous systems, approximately half of the KCS family members—potentially including KCS15—have not yet been fully characterized functionally . This highlights the importance of comparative analyses across the entire KCS family to understand the unique contributions of each enzyme.

What expression patterns does KCS15 exhibit across different tissues and developmental stages?

While the search results don't provide specific information about KCS15 expression patterns, research approaches to determine expression patterns would include:

Tissue-specific expression analysis using RT-PCR or RNA-seq data across different plant tissues (roots, leaves, stems, flowers, seeds) and developmental stages (from germination to mature seed) . These techniques can reveal whether KCS15 has constitutive expression or shows tissue/developmental specificity. Based on studies with other KCS family members, expression patterns often correlate with functional roles—for example, KCS18/FAE1 shows seed-specific expression corresponding to its role in seed oil biosynthesis .

Stress-responsive expression patterns can be examined using techniques like cDNA microarrays to determine if KCS15 expression changes under various environmental stresses such as drought, cold, or wounding . For instance, similar to how some genes were identified as drought- or cold-inducible in Arabidopsis using full-length cDNA microarrays, KCS15 could potentially show stress-responsive expression patterns that provide clues to its physiological roles .

What are the most effective methods for producing high-purity recombinant KCS15 protein for functional studies?

For producing high-purity recombinant KCS15 protein, several expression systems have proven effective for KCS family proteins:

  • Cell-free expression systems: Based on available recombinant KCS15 products, cell-free expression systems appear to be effective for producing functionally active KCS15 with purity levels of ≥85% as determined by SDS-PAGE . This approach may avoid challenges associated with membrane protein expression in cellular systems.

  • Heterologous expression in yeast: For functional characterization, expression in engineered yeast strains has been successfully employed for multiple KCS enzymes . The advantage of this system is that it allows for in vivo functional analysis by measuring the production of specific VLCFAs. When expressing KCS15 in yeast, it's crucial to consider:

    • Using a yeast strain with reduced or eliminated endogenous elongase activity to minimize background

    • Co-expression with other components of the elongase complex if necessary

    • Providing appropriate substrates for testing chain-length specificity

  • Transient expression in Nicotiana benthamiana: For subcellular localization and preliminary functional studies, Agrobacterium-mediated transient expression in N. benthamiana leaves has been used effectively for other KCS enzymes . This system allows for:

    • Visualization of protein localization using fluorescent tags

    • Analysis of VLCFA profiles after overexpression

    • Relatively quick results (analysis 2-5 days after infiltration)

When purifying the recombinant protein, affinity chromatography with appropriate tags (His, GST, etc.) followed by size exclusion chromatography is typically used to achieve high purity (≥85%) .

How can I design effective CRISPR-Cas9 experiments to study KCS15 function in Arabidopsis?

Designing effective CRISPR-Cas9 experiments for KCS15 functional studies requires careful consideration of several factors:

  • Guide RNA (gRNA) design:

    • Target functionally critical regions such as the catalytic domain

    • Design multiple gRNAs to increase knockout efficiency

    • Check for off-target effects using appropriate bioinformatic tools

    • Consider designing gRNAs that target regions conserved between KCS15 and other functionally redundant KCS genes for multiplex editing

  • Addressing functional redundancy:

    • Given the high functional redundancy in the KCS family (21 genes in Arabidopsis), single knockout of KCS15 may not produce observable phenotypes

    • Consider creating multiplex CRISPR systems targeting KCS15 along with its closest functional homologs

    • Alternatively, use CRISPR to insert specific mutations rather than complete knockouts to alter substrate specificity

  • Transformation and screening:

    • Use established Arabidopsis transformation protocols (floral dip method)

    • Design PCR-based screening strategies to identify edited plants

    • Sequence the target region to confirm the exact nature of the mutations

  • Phenotypic analysis:

    • Analyze VLCFA profiles in multiple tissues (leaves, stems, seeds) using gas chromatography-mass spectrometry (GC-MS)

    • Examine cuticular wax composition and structure

    • Assess developmental phenotypes and stress responses, particularly if KCS15 is involved in stress-responsive VLCFA production

  • Controls and validation:

    • Include complementation experiments with wild-type KCS15 to confirm phenotype specificity

    • Use quantitative RT-PCR to confirm knockout/knockdown at the transcript level

    • Consider creating tagged versions for protein expression verification

Similar CRISPR-Cas9 approaches have been successfully used for studying other plant genes involved in lipid metabolism and have proven valuable for addressing functional redundancy issues .

What are the best approaches to analyze substrate specificity of KCS15 in vitro and in vivo?

Analyzing the substrate specificity of KCS15 requires complementary in vitro and in vivo approaches:

In vitro approaches:

  • Enzyme assays with purified recombinant KCS15:

    • Incubate purified KCS15 with various acyl-CoA substrates of different chain lengths (C16-C24)

    • Include labeled malonyl-CoA as the 2-carbon donor

    • Analyze reaction products using HPLC or LC-MS/MS

    • Determine kinetic parameters (Km, Vmax) for different substrates to quantify preferences

  • Reconstitution of the complete elongase complex:

    • Co-express KCS15 with other components of the fatty acid elongase complex (KCR, HCD, ECR)

    • Test activity with various substrates in the reconstituted system

    • Compare activity levels to established KCS enzymes with known specificities

In vivo approaches:

  • Heterologous expression in yeast:

    • Express KCS15 in engineered yeast strains lacking endogenous elongase activity

    • Analyze the VLCFA profile using GC-MS

    • Compare profiles with control yeast and yeast expressing other KCS enzymes

    • This approach has successfully characterized nine Arabidopsis KCS enzymes previously

  • Transient expression in Nicotiana benthamiana:

    • Express KCS15 in tobacco leaves through Agrobacterium-mediated transformation

    • Analyze changes in VLCFA profiles 5 days after infiltration

    • This system provides a plant cellular environment that may be more relevant than yeast

  • Complementation studies in Arabidopsis:

    • Express KCS15 in Arabidopsis mutants lacking specific KCS enzymes

    • Determine if KCS15 can rescue the phenotype, indicating overlapping substrate specificity

    • Analyze VLCFA profiles in the complemented lines

By combining these approaches, researchers can develop a comprehensive understanding of KCS15 substrate specificity, which is essential for determining its physiological role in VLCFA biosynthesis.

How do I address the functional redundancy problem when studying KCS15 among 21 KCS genes in Arabidopsis?

Addressing functional redundancy in the KCS gene family requires multi-faceted approaches:

  • Comprehensive expression analysis:

    • Perform detailed expression profiling of all 21 KCS genes across tissues, developmental stages, and stress conditions

    • Identify co-expression patterns to reveal KCS genes likely to have overlapping functions with KCS15

    • Use tools like cDNA microarrays or RNA-seq to generate expression maps

  • Phylogenetic analysis:

    • Construct phylogenetic trees of the KCS family to identify the closest homologs to KCS15

    • Focus on creating mutants of KCS15 along with its closest homologs

    • This approach can help prioritize which combinations of KCS genes to target

  • Higher-order mutants:

    • Generate double, triple, or higher-order mutants combining kcs15 with mutations in genes showing similar expression patterns

    • Screen these higher-order mutants for phenotypes not observed in single mutants

    • Use CRISPR-Cas9 for efficient multiplex gene editing

  • Tissue-specific or inducible silencing:

    • Use artificial microRNAs or RNAi constructs targeting conserved regions of multiple KCS genes

    • Employ tissue-specific or inducible promoters to control the timing and location of silencing

    • This approach can help bypass developmental lethality that might result from constitutive silencing

  • Biochemical complementation analysis:

    • Express each KCS in a standardized system (such as the engineered yeast platform mentioned in search result )

    • Compare substrate specificities and products systematically

    • Identify unique activities of KCS15 compared to other family members

  • Data integration and network analysis:

    • Combine transcriptomic, proteomic, and metabolomic data

    • Build network models to predict functional relationships between KCS15 and other KCS genes

    • Use these models to guide experimental designs

By systematically applying these approaches, researchers can disentangle the contributions of KCS15 from other functionally redundant KCS enzymes and identify its unique roles in VLCFA biosynthesis.

What analytical techniques provide the most accurate quantification of KCS15-produced very-long-chain fatty acids (VLCFAs)?

For accurate quantification of VLCFAs produced through KCS15 activity, several complementary analytical techniques are recommended:

  • Gas Chromatography-Mass Spectrometry (GC-MS):

    • Most widely used technique for VLCFA analysis

    • Requires derivatization (typically methylation) of fatty acids to increase volatility

    • Provides excellent separation of fatty acids with different chain lengths and degrees of unsaturation

    • Can detect VLCFAs in the range of C20-C36 commonly found in plants

    • Enables quantification using appropriate internal standards

  • Liquid Chromatography-Mass Spectrometry (LC-MS/MS):

    • Allows analysis of intact lipid species without derivatization

    • Can distinguish between free fatty acids and those incorporated into complex lipids

    • Multiple reaction monitoring (MRM) provides high sensitivity and specificity

    • Particularly useful for analyzing low-abundance VLCFAs or unusual modifications

  • Matrix-Assisted Laser Desorption/Ionization (MALDI)-MS:

    • Useful for rapid screening of lipid profiles

    • Less quantitative than GC-MS or LC-MS/MS but provides a quick overview

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Provides structural information about fatty acids

    • Less sensitive than MS-based methods but gives detailed information about position of double bonds and other modifications

  • Thin-Layer Chromatography (TLC) coupled with autoradiography:

    • For in vitro enzyme assays using radiolabeled substrates

    • Allows visualization of newly synthesized products

    • Can be followed by scintillation counting for quantification

For comparative analysis, the following data processing approaches are recommended:

  • Use appropriate internal standards (ideally stable isotope-labeled VLCFAs)

  • Normalize to sample weight or total lipid content

  • Perform statistical analysis to determine significant differences

  • Present data as both absolute quantification (nmol/g fresh weight) and relative composition (mol%)

This multi-technique approach enables accurate quantification and characterization of VLCFAs produced through KCS15 activity in various experimental systems.

How can I interpret contradictory results between in vitro and in vivo KCS15 activity studies?

When facing contradictory results between in vitro and in vivo KCS15 activity studies, consider the following analytical framework:

  • Systematic evaluation of experimental differences:

    ParameterIn vitro systemIn vivo systemPotential impact
    Substrate availabilityLimited to added substratesComplete cellular poolMay miss physiological substrates in vitro
    Enzyme cofactorsMay be missing or at non-physiological concentrationsComplete cellular complementAltered enzyme kinetics
    Protein modificationsMay lack post-translational modificationsFully modified proteinAltered activity or specificity
    Protein-protein interactionsIsolated enzyme or partial complexComplete elongase complexMissing regulatory interactions
    Membrane environmentArtificial or absentNative ER membraneAltered structural conformation
  • Address specific contradictions methodically:

    • Substrate specificity differences: If KCS15 shows different substrate preferences in vitro versus in vivo, examine whether all potential substrates were tested in vitro. Some KCS enzymes may require specific acyl-CoA species that might not be available in standard assays .

    • Activity differences: If KCS15 shows activity in one system but not the other, consider whether all components of the elongase complex are present. Research has shown that plant KCS proteins may interact poorly with yeast elongase components, affecting activity measurement .

    • Product profile differences: Different products in vitro versus in vivo may indicate downstream modifications occurring in cellular environments. Analyze the complete lipid profile rather than just immediate products.

  • Reconciliation strategies:

    • Reconstruct increasingly complex in vitro systems (adding membrane fractions, other elongase components)

    • Use semi-in vivo approaches like microsomal assays that maintain more native conditions

    • Perform site-directed mutagenesis to identify specific residues causing discrepancies

    • Express KCS15 variants in heterologous systems with different capabilities

    • Consider tissue-specific factors that might influence activity in vivo

  • Reporting recommendations:

    • Clearly document all experimental conditions

    • Present both contradictory data sets with appropriate controls

    • Propose testable hypotheses to explain discrepancies

    • Acknowledge limitations of each experimental system

This systematic approach helps researchers interpret contradictory results as valuable insights into the contextual requirements for KCS15 function rather than experimental failures.

How does KCS15 function change under various abiotic stress conditions, and what are the implications for plant stress resistance?

The relationship between KCS15 function and abiotic stress responses represents an important research frontier:

KCS enzymes and the VLCFAs they produce play crucial roles in plant stress responses, particularly through their contributions to cuticular wax and membrane lipid composition. While specific information about KCS15 stress responses is limited in the search results, approaches to investigate this question include:

  • Stress-responsive expression analysis:

    • Examine KCS15 expression under drought, cold, salt, and heat stress conditions using RT-PCR or RNA-seq

    • Compare with expression patterns of other KCS genes to identify stress-specific regulation

    • Look for transcription factor binding sites in the KCS15 promoter, particularly stress-responsive elements like DRE/CRT motifs that interact with DREB/CBF transcription factors

  • Stress phenotype analysis of KCS15 mutants:

    • Compare wild-type and kcs15 mutant responses to various stresses

    • Measure physiological parameters like water loss rate, electrolyte leakage, and lipid peroxidation

    • Analyze cuticular wax composition and structure under stress conditions

  • Biochemical adaptation:

    • Determine if KCS15 substrate specificity changes under stress conditions

    • Analyze whether stress alters post-translational modifications of KCS15

    • Investigate stress-induced changes in KCS15 protein stability and turnover

  • Metabolic network analysis:

    • Map how stress-induced changes in KCS15 activity affect downstream lipid profiles

    • Identify metabolic bottlenecks or regulatory points in VLCFA biosynthesis during stress

    • Integrate with transcriptomics data to build comprehensive stress response models

The search results indicate that some genes in Arabidopsis are specifically induced by drought and cold stress, with certain genes controlled by the DREB1A transcription factor that binds to DRE/CRT elements . If KCS15 contains such regulatory elements in its promoter, it might be part of a coordinated stress response network that modifies membrane and cuticular lipid composition to enhance stress resistance.

What role might KCS15 play in plant-microbe interactions and disease resistance?

The potential role of KCS15 in plant-microbe interactions and disease resistance can be investigated through several research approaches:

  • Pathogen challenge experiments:

    • Challenge wild-type and kcs15 mutant plants with various pathogens (bacterial, fungal, oomycete)

    • Assess disease progression, pathogen growth, and symptom development

    • Determine if KCS15 expression changes during pathogen infection using qRT-PCR

  • Cuticle integrity analysis:

    • VLCFAs are essential components of the plant cuticle, which serves as the first physical barrier against pathogens

    • Analyze cuticle permeability using dye penetration assays in kcs15 mutants

    • Examine cuticle ultrastructure using electron microscopy

    • Test for altered pathogen penetration rates in plants with modified KCS15 expression

  • Defense signaling integration:

    • Determine if KCS15 expression responds to defense hormones (salicylic acid, jasmonic acid, ethylene)

    • Investigate whether defense-related transcription factors regulate KCS15

    • Analyze cross-talk between VLCFA-derived signals and canonical defense pathways

  • Specialized metabolite production:

    • VLCFAs serve as precursors for certain defense-related secondary metabolites

    • Profile specialized metabolites in wild-type versus kcs15 plants before and after pathogen challenge

    • Identify specific metabolites that may be affected by altered KCS15 activity

  • Subcellular dynamics during infection:

    • Examine changes in KCS15 localization during pathogen challenge using fluorescent protein fusions

    • Investigate whether pathogens specifically target or modify KCS15 function

While the search results don't specifically address KCS15 in pathogen interactions, research on plant fatty acid metabolism suggests that VLCFAs and their derivatives play important roles in both constitutive and induced defense responses. Systematic investigation of KCS15 in this context may reveal novel functions in disease resistance mechanisms.

How can systems biology approaches be used to position KCS15 within the broader context of plant lipid metabolism?

Systems biology offers powerful approaches for understanding KCS15's role within the complex network of plant lipid metabolism:

  • Multi-omics data integration:

    • Combine transcriptomics, proteomics, metabolomics, and lipidomics data

    • Construct correlation networks to identify genes/proteins/metabolites that co-regulate with KCS15

    • Use temporal dynamics (time-series experiments) to establish cause-effect relationships

    • This approach can reveal unexpected connections between KCS15 and other metabolic pathways

  • Genome-scale metabolic modeling:

    • Incorporate KCS15 reactions into genome-scale metabolic models of Arabidopsis

    • Perform flux balance analysis to predict system-wide effects of KCS15 perturbation

    • Identify potential metabolic bottlenecks or regulatory points

    • Simulate environmental or genetic perturbations to predict KCS15 contributions under various conditions

  • Protein-protein interaction network analysis:

    • Identify KCS15 interaction partners using techniques like yeast two-hybrid, co-immunoprecipitation, or proximity labeling

    • Map these interactions to build a KCS15-centered interaction network

    • Compare with interaction networks of other KCS enzymes to identify unique and shared features

  • Comparative genomics and evolution:

    • Analyze KCS15 orthologs across plant species

    • Correlate evolutionary patterns with species-specific lipid profiles

    • Identify conserved regulatory elements in KCS gene promoters

    • This approach can reveal evolutionary constraints and adaptations in VLCFA metabolism

  • Machine learning for functional prediction:

    • Develop predictive models using existing experimental data on KCS enzymes

    • Generate testable hypotheses about KCS15 function based on sequence, structure, and expression features

    • Validate predictions with targeted experiments

By positioning KCS15 within this broader systems context, researchers can:

  • Identify emergent properties not evident from reductionist approaches

  • Predict how KCS15 perturbations propagate through the metabolic network

  • Discover novel regulatory relationships governing VLCFA biosynthesis

  • Design rational metabolic engineering strategies for modifying plant lipid composition

This systems approach complements traditional biochemical and genetic studies by providing a holistic view of KCS15 function in plant metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.