Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 15 (KCS15) is an enzyme that functions in the elongation of fatty acids . Specifically, KCS15 is involved in the synthesis of very long-chain fatty acids (VLCFAs) . In Arabidopsis thaliana, there are 21 KCS members, which catalyze the first committed step in the elongation of fatty acids, adding two carbons to the acyl chain in each cycle . KCS15 is expressed in the tapetum, a layer of cells in the anther that nourishes developing pollen . It acts redundantly with KCS7 and KCS21 in pollen coat lipid synthesis, which is essential for pollen hydration .
KCS15 is also known by the following names :
At3g52160
F4F15.270
3-ketoacyl-CoA synthase 15
KCS-15
Very long-chain fatty acid condensing enzyme 15
VLCFA condensing enzyme 15
Recombinant KCS15 can be produced in various expression systems, including E. coli, yeast, baculovirus, and mammalian cells . The recombinant protein is available with different tags, such as a His-tag, which facilitates purification . KCS15 is available from commercial sources for research purposes .
| Code | Source | Conjugate |
|---|---|---|
| CSB-YP886789DOA1 | Yeast | N/A |
| CSB-EP886789DOA1 | E. coli | N/A |
| CSB-EP886789DOA1-B | E. coli | Avi-tag Biotinylated (E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology) |
| CSB-BP886789DOA1 | Baculovirus | N/A |
| CSB-MP886789DOA1 | Mammalian cell | N/A |
KCS15 is a full-length protein consisting of 451 amino acids . It belongs to the 3-ketoacyl-CoA synthase family of enzymes, which are crucial for the elongation of fatty acids . These enzymes catalyze the condensation reaction that adds two carbons to the growing acyl chain .
| Feature | Description |
|---|---|
| Species | Arabidopsis thaliana |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length (1-451) |
| Amino Acid Sequence | MEKEATKMVNGGVKSKSPKGSPDFLGYNLRYVKLGYIYLLSLSRTFCFFLPPLLLLFIFV SRFLPILAFPLSTFFILLIYHYLTPSSVFLLDFSCYRPPDHLKITKSDFIELAMKSGNFN ETAIELQRKVLDQSGIGEESYMPRVVFKPGHRVNLRDGREEAAMVIFGAIDELLAATKIN VKHIKILVLNCGVLNTTPSLSAMVINHYKLRHNTESYNLGGMGCSAGVIAIDLAKDLLNA HQGSYALVVSTEIVSFTWYSGNDVALLPPNCFFRMGAAAVMLSSRRIDRWRAKYQLMQLV RTHKGMEDTSYKSIELREDRDGKQGLYVSRDVMEVGRHALKANIATLGRLEPSFEHICVL ASSKKVLDDIHKDLKLTEENMEASRRTLERFGNTSSSSIWYELAYLEHKAKMKRGDRVWQ IGFGSGFKCNSVVWKALKNIDPPRHNNPWNL |
| Purity | Greater than 90% as determined by SDS-PAGE |
KCS15 plays a role in fatty acid biosynthesis, particularly in the production of VLCFAs . VLCFAs are essential components of various plant lipids, including cuticular waxes and seed storage lipids . The co-expression of KCS15 with CRC and AP1 suggests its involvement in fatty acid biosynthesis . CRC can bind to the promoter regions of KCS7 and KCS15, indicating that CRC may directly regulate fatty acid biosynthesis .
3-ketoacyl-CoA synthase 15 (KCS15) is a member of the KCS enzyme family in Arabidopsis thaliana that catalyzes the initial condensation reaction in the fatty acid elongation (FAE) process. As part of the fatty acid elongase complex, KCS15 contributes to the biosynthesis of very-long-chain fatty acids (VLCFAs), which are essential components of plant cuticular waxes, suberin, and membrane lipids . The KCS family in Arabidopsis consists of 21 identified genes that exhibit varying degrees of substrate specificity and tissue expression patterns, leading to functional specialization and redundancy . While specific functions of KCS15 are still being elucidated, it likely contributes to the diverse array of VLCFAs found in different plant tissues and developmental stages.
KCS15 is one of the 21 KCS enzymes in Arabidopsis that share core catalytic domains but differ in substrate specificity and expression patterns. Structurally, all KCS enzymes contain conserved domains for fatty acid binding and condensation activity, but variations in specific amino acid residues likely influence substrate chain-length preferences and reaction kinetics . Unlike well-characterized members such as KCS1 (involved in wax biosynthesis producing C20-C22 VLCFAs), KCS18/FAE1 (producing seed-specific C20-C22 VLCFAs), or KCS16 (involved in trichome wax production), the precise substrate specificity of KCS15 requires further characterization .
Functional differentiation among KCS enzymes is evidenced by their diverse expression patterns across tissues and in response to environmental stresses. While some KCS genes like KCS1 and KCS16 show mutant phenotypes and have been successfully characterized in heterologous systems, approximately half of the KCS family members—potentially including KCS15—have not yet been fully characterized functionally . This highlights the importance of comparative analyses across the entire KCS family to understand the unique contributions of each enzyme.
While the search results don't provide specific information about KCS15 expression patterns, research approaches to determine expression patterns would include:
Tissue-specific expression analysis using RT-PCR or RNA-seq data across different plant tissues (roots, leaves, stems, flowers, seeds) and developmental stages (from germination to mature seed) . These techniques can reveal whether KCS15 has constitutive expression or shows tissue/developmental specificity. Based on studies with other KCS family members, expression patterns often correlate with functional roles—for example, KCS18/FAE1 shows seed-specific expression corresponding to its role in seed oil biosynthesis .
Stress-responsive expression patterns can be examined using techniques like cDNA microarrays to determine if KCS15 expression changes under various environmental stresses such as drought, cold, or wounding . For instance, similar to how some genes were identified as drought- or cold-inducible in Arabidopsis using full-length cDNA microarrays, KCS15 could potentially show stress-responsive expression patterns that provide clues to its physiological roles .
For producing high-purity recombinant KCS15 protein, several expression systems have proven effective for KCS family proteins:
Cell-free expression systems: Based on available recombinant KCS15 products, cell-free expression systems appear to be effective for producing functionally active KCS15 with purity levels of ≥85% as determined by SDS-PAGE . This approach may avoid challenges associated with membrane protein expression in cellular systems.
Heterologous expression in yeast: For functional characterization, expression in engineered yeast strains has been successfully employed for multiple KCS enzymes . The advantage of this system is that it allows for in vivo functional analysis by measuring the production of specific VLCFAs. When expressing KCS15 in yeast, it's crucial to consider:
Using a yeast strain with reduced or eliminated endogenous elongase activity to minimize background
Co-expression with other components of the elongase complex if necessary
Providing appropriate substrates for testing chain-length specificity
Transient expression in Nicotiana benthamiana: For subcellular localization and preliminary functional studies, Agrobacterium-mediated transient expression in N. benthamiana leaves has been used effectively for other KCS enzymes . This system allows for:
Visualization of protein localization using fluorescent tags
Analysis of VLCFA profiles after overexpression
Relatively quick results (analysis 2-5 days after infiltration)
When purifying the recombinant protein, affinity chromatography with appropriate tags (His, GST, etc.) followed by size exclusion chromatography is typically used to achieve high purity (≥85%) .
Designing effective CRISPR-Cas9 experiments for KCS15 functional studies requires careful consideration of several factors:
Guide RNA (gRNA) design:
Target functionally critical regions such as the catalytic domain
Design multiple gRNAs to increase knockout efficiency
Check for off-target effects using appropriate bioinformatic tools
Consider designing gRNAs that target regions conserved between KCS15 and other functionally redundant KCS genes for multiplex editing
Addressing functional redundancy:
Given the high functional redundancy in the KCS family (21 genes in Arabidopsis), single knockout of KCS15 may not produce observable phenotypes
Consider creating multiplex CRISPR systems targeting KCS15 along with its closest functional homologs
Alternatively, use CRISPR to insert specific mutations rather than complete knockouts to alter substrate specificity
Transformation and screening:
Use established Arabidopsis transformation protocols (floral dip method)
Design PCR-based screening strategies to identify edited plants
Sequence the target region to confirm the exact nature of the mutations
Phenotypic analysis:
Analyze VLCFA profiles in multiple tissues (leaves, stems, seeds) using gas chromatography-mass spectrometry (GC-MS)
Examine cuticular wax composition and structure
Assess developmental phenotypes and stress responses, particularly if KCS15 is involved in stress-responsive VLCFA production
Controls and validation:
Include complementation experiments with wild-type KCS15 to confirm phenotype specificity
Use quantitative RT-PCR to confirm knockout/knockdown at the transcript level
Consider creating tagged versions for protein expression verification
Similar CRISPR-Cas9 approaches have been successfully used for studying other plant genes involved in lipid metabolism and have proven valuable for addressing functional redundancy issues .
Analyzing the substrate specificity of KCS15 requires complementary in vitro and in vivo approaches:
In vitro approaches:
Enzyme assays with purified recombinant KCS15:
Incubate purified KCS15 with various acyl-CoA substrates of different chain lengths (C16-C24)
Include labeled malonyl-CoA as the 2-carbon donor
Analyze reaction products using HPLC or LC-MS/MS
Determine kinetic parameters (Km, Vmax) for different substrates to quantify preferences
Reconstitution of the complete elongase complex:
Co-express KCS15 with other components of the fatty acid elongase complex (KCR, HCD, ECR)
Test activity with various substrates in the reconstituted system
Compare activity levels to established KCS enzymes with known specificities
In vivo approaches:
Heterologous expression in yeast:
Transient expression in Nicotiana benthamiana:
Complementation studies in Arabidopsis:
Express KCS15 in Arabidopsis mutants lacking specific KCS enzymes
Determine if KCS15 can rescue the phenotype, indicating overlapping substrate specificity
Analyze VLCFA profiles in the complemented lines
By combining these approaches, researchers can develop a comprehensive understanding of KCS15 substrate specificity, which is essential for determining its physiological role in VLCFA biosynthesis.
Addressing functional redundancy in the KCS gene family requires multi-faceted approaches:
Comprehensive expression analysis:
Phylogenetic analysis:
Construct phylogenetic trees of the KCS family to identify the closest homologs to KCS15
Focus on creating mutants of KCS15 along with its closest homologs
This approach can help prioritize which combinations of KCS genes to target
Higher-order mutants:
Tissue-specific or inducible silencing:
Use artificial microRNAs or RNAi constructs targeting conserved regions of multiple KCS genes
Employ tissue-specific or inducible promoters to control the timing and location of silencing
This approach can help bypass developmental lethality that might result from constitutive silencing
Biochemical complementation analysis:
Data integration and network analysis:
Combine transcriptomic, proteomic, and metabolomic data
Build network models to predict functional relationships between KCS15 and other KCS genes
Use these models to guide experimental designs
By systematically applying these approaches, researchers can disentangle the contributions of KCS15 from other functionally redundant KCS enzymes and identify its unique roles in VLCFA biosynthesis.
For accurate quantification of VLCFAs produced through KCS15 activity, several complementary analytical techniques are recommended:
Gas Chromatography-Mass Spectrometry (GC-MS):
Most widely used technique for VLCFA analysis
Requires derivatization (typically methylation) of fatty acids to increase volatility
Provides excellent separation of fatty acids with different chain lengths and degrees of unsaturation
Can detect VLCFAs in the range of C20-C36 commonly found in plants
Enables quantification using appropriate internal standards
Liquid Chromatography-Mass Spectrometry (LC-MS/MS):
Allows analysis of intact lipid species without derivatization
Can distinguish between free fatty acids and those incorporated into complex lipids
Multiple reaction monitoring (MRM) provides high sensitivity and specificity
Particularly useful for analyzing low-abundance VLCFAs or unusual modifications
Matrix-Assisted Laser Desorption/Ionization (MALDI)-MS:
Useful for rapid screening of lipid profiles
Less quantitative than GC-MS or LC-MS/MS but provides a quick overview
Nuclear Magnetic Resonance (NMR) Spectroscopy:
Provides structural information about fatty acids
Less sensitive than MS-based methods but gives detailed information about position of double bonds and other modifications
Thin-Layer Chromatography (TLC) coupled with autoradiography:
For in vitro enzyme assays using radiolabeled substrates
Allows visualization of newly synthesized products
Can be followed by scintillation counting for quantification
For comparative analysis, the following data processing approaches are recommended:
Use appropriate internal standards (ideally stable isotope-labeled VLCFAs)
Normalize to sample weight or total lipid content
Perform statistical analysis to determine significant differences
Present data as both absolute quantification (nmol/g fresh weight) and relative composition (mol%)
This multi-technique approach enables accurate quantification and characterization of VLCFAs produced through KCS15 activity in various experimental systems.
When facing contradictory results between in vitro and in vivo KCS15 activity studies, consider the following analytical framework:
Systematic evaluation of experimental differences:
| Parameter | In vitro system | In vivo system | Potential impact |
|---|---|---|---|
| Substrate availability | Limited to added substrates | Complete cellular pool | May miss physiological substrates in vitro |
| Enzyme cofactors | May be missing or at non-physiological concentrations | Complete cellular complement | Altered enzyme kinetics |
| Protein modifications | May lack post-translational modifications | Fully modified protein | Altered activity or specificity |
| Protein-protein interactions | Isolated enzyme or partial complex | Complete elongase complex | Missing regulatory interactions |
| Membrane environment | Artificial or absent | Native ER membrane | Altered structural conformation |
Address specific contradictions methodically:
Substrate specificity differences: If KCS15 shows different substrate preferences in vitro versus in vivo, examine whether all potential substrates were tested in vitro. Some KCS enzymes may require specific acyl-CoA species that might not be available in standard assays .
Activity differences: If KCS15 shows activity in one system but not the other, consider whether all components of the elongase complex are present. Research has shown that plant KCS proteins may interact poorly with yeast elongase components, affecting activity measurement .
Product profile differences: Different products in vitro versus in vivo may indicate downstream modifications occurring in cellular environments. Analyze the complete lipid profile rather than just immediate products.
Reconciliation strategies:
Reconstruct increasingly complex in vitro systems (adding membrane fractions, other elongase components)
Use semi-in vivo approaches like microsomal assays that maintain more native conditions
Perform site-directed mutagenesis to identify specific residues causing discrepancies
Express KCS15 variants in heterologous systems with different capabilities
Consider tissue-specific factors that might influence activity in vivo
Reporting recommendations:
Clearly document all experimental conditions
Present both contradictory data sets with appropriate controls
Propose testable hypotheses to explain discrepancies
Acknowledge limitations of each experimental system
This systematic approach helps researchers interpret contradictory results as valuable insights into the contextual requirements for KCS15 function rather than experimental failures.
The relationship between KCS15 function and abiotic stress responses represents an important research frontier:
KCS enzymes and the VLCFAs they produce play crucial roles in plant stress responses, particularly through their contributions to cuticular wax and membrane lipid composition. While specific information about KCS15 stress responses is limited in the search results, approaches to investigate this question include:
Stress-responsive expression analysis:
Examine KCS15 expression under drought, cold, salt, and heat stress conditions using RT-PCR or RNA-seq
Compare with expression patterns of other KCS genes to identify stress-specific regulation
Look for transcription factor binding sites in the KCS15 promoter, particularly stress-responsive elements like DRE/CRT motifs that interact with DREB/CBF transcription factors
Stress phenotype analysis of KCS15 mutants:
Compare wild-type and kcs15 mutant responses to various stresses
Measure physiological parameters like water loss rate, electrolyte leakage, and lipid peroxidation
Analyze cuticular wax composition and structure under stress conditions
Biochemical adaptation:
Determine if KCS15 substrate specificity changes under stress conditions
Analyze whether stress alters post-translational modifications of KCS15
Investigate stress-induced changes in KCS15 protein stability and turnover
Metabolic network analysis:
Map how stress-induced changes in KCS15 activity affect downstream lipid profiles
Identify metabolic bottlenecks or regulatory points in VLCFA biosynthesis during stress
Integrate with transcriptomics data to build comprehensive stress response models
The search results indicate that some genes in Arabidopsis are specifically induced by drought and cold stress, with certain genes controlled by the DREB1A transcription factor that binds to DRE/CRT elements . If KCS15 contains such regulatory elements in its promoter, it might be part of a coordinated stress response network that modifies membrane and cuticular lipid composition to enhance stress resistance.
The potential role of KCS15 in plant-microbe interactions and disease resistance can be investigated through several research approaches:
Pathogen challenge experiments:
Challenge wild-type and kcs15 mutant plants with various pathogens (bacterial, fungal, oomycete)
Assess disease progression, pathogen growth, and symptom development
Determine if KCS15 expression changes during pathogen infection using qRT-PCR
Cuticle integrity analysis:
VLCFAs are essential components of the plant cuticle, which serves as the first physical barrier against pathogens
Analyze cuticle permeability using dye penetration assays in kcs15 mutants
Examine cuticle ultrastructure using electron microscopy
Test for altered pathogen penetration rates in plants with modified KCS15 expression
Defense signaling integration:
Determine if KCS15 expression responds to defense hormones (salicylic acid, jasmonic acid, ethylene)
Investigate whether defense-related transcription factors regulate KCS15
Analyze cross-talk between VLCFA-derived signals and canonical defense pathways
Specialized metabolite production:
VLCFAs serve as precursors for certain defense-related secondary metabolites
Profile specialized metabolites in wild-type versus kcs15 plants before and after pathogen challenge
Identify specific metabolites that may be affected by altered KCS15 activity
Subcellular dynamics during infection:
Examine changes in KCS15 localization during pathogen challenge using fluorescent protein fusions
Investigate whether pathogens specifically target or modify KCS15 function
While the search results don't specifically address KCS15 in pathogen interactions, research on plant fatty acid metabolism suggests that VLCFAs and their derivatives play important roles in both constitutive and induced defense responses. Systematic investigation of KCS15 in this context may reveal novel functions in disease resistance mechanisms.
Systems biology offers powerful approaches for understanding KCS15's role within the complex network of plant lipid metabolism:
Multi-omics data integration:
Combine transcriptomics, proteomics, metabolomics, and lipidomics data
Construct correlation networks to identify genes/proteins/metabolites that co-regulate with KCS15
Use temporal dynamics (time-series experiments) to establish cause-effect relationships
This approach can reveal unexpected connections between KCS15 and other metabolic pathways
Genome-scale metabolic modeling:
Incorporate KCS15 reactions into genome-scale metabolic models of Arabidopsis
Perform flux balance analysis to predict system-wide effects of KCS15 perturbation
Identify potential metabolic bottlenecks or regulatory points
Simulate environmental or genetic perturbations to predict KCS15 contributions under various conditions
Protein-protein interaction network analysis:
Identify KCS15 interaction partners using techniques like yeast two-hybrid, co-immunoprecipitation, or proximity labeling
Map these interactions to build a KCS15-centered interaction network
Compare with interaction networks of other KCS enzymes to identify unique and shared features
Comparative genomics and evolution:
Analyze KCS15 orthologs across plant species
Correlate evolutionary patterns with species-specific lipid profiles
Identify conserved regulatory elements in KCS gene promoters
This approach can reveal evolutionary constraints and adaptations in VLCFA metabolism
Machine learning for functional prediction:
Develop predictive models using existing experimental data on KCS enzymes
Generate testable hypotheses about KCS15 function based on sequence, structure, and expression features
Validate predictions with targeted experiments
By positioning KCS15 within this broader systems context, researchers can:
Identify emergent properties not evident from reductionist approaches
Predict how KCS15 perturbations propagate through the metabolic network
Discover novel regulatory relationships governing VLCFA biosynthesis
Design rational metabolic engineering strategies for modifying plant lipid composition
This systems approach complements traditional biochemical and genetic studies by providing a holistic view of KCS15 function in plant metabolism.