Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 16 (KCS16)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
KCS16; EL2; At4g34250; F10M10.20; 3-ketoacyl-CoA synthase 16; KCS-16; Very long-chain fatty acid condensing enzyme 16; VLCFA condensing enzyme 16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-493
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
KCS16
Target Protein Sequence
SRLSTQDLQNFYLYLQNNHTSLTMFFLYLALGSTLYLMTRPKPVYLVDFSCYLPPSHLKA
STQRIMQHVRLVREAGAWKQESDYLMDFCEKILERSGLGQETYVPEGLQTLPLQQNLAVS
RIETEEVIIGAVDNLFRNTGISPSDIGILVVNSSTFNPTPSLSSILVNKFKLRDNIKSLN
LGGMGCSAGVIAIDAAKSLLQVHRNTYALVVSTENITQNLYMGNNKSMLVTNCLFRIGGA
AILLSNRSIDRKRAKYELVHTVRVHTGADDRSYECATQEEDEDGIVGVSLSKNLPMVAAR
TLKINIATLGPLVLPISEKFHFFVRFVKKKFLNPKLKHYIPDFKLAFEHFCIHAGGRALI
DEMEKNLHLTPLDVEASRMTLHRFGNTSSSSIWYELAYTEAKGRMTKGDRIWQIALGSGF
KCNSSVWVALRNVKPSTNNPWEQCLHKYPVEIDIDLKE
Uniprot No.
Target Background
Gene References Into Functions
- KCS16 is the sole enzyme responsible for elongating C34 to C38 acyl-CoAs in Arabidopsis leaf trichomes, contributing to the formation of extra-long chain compounds in adjacent pavement cells. PMID: 28477442
Database Links
Protein Families
Chalcone/stilbene synthases family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in siliques.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
