Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 17 (KCS17)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
KCS2; DAISY; KCS17; At1g04220; F20D22.1; 3-ketoacyl-CoA synthase 2; KCS-2; Docosanoic acid synthase; Very long-chain fatty acid condensing enzyme 2; VLCFA condensing enzyme 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-528
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
KCS2
Target Protein Sequence
MNENHIQSDHMNNTIHVTNKKLPNFLLSVRLKYVKLGYHYLISNAVYILILPVGLLAATS SSFSLTDLTLLYNHLLKFHFLSSTLFAALLIFLTTLYFTTRPRRIFLLDFACYKPDSSLI CTRETFMDRSQRVGIFTEDNLAFQQKILERSGLGQKTYFPEALLRVPPNPCMSEARKEAE TVMFGAIDAVLEKTGVNPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNVLSYNLGGMG CSAGLISIDLAKQLLQVQPNSYALVVSTENITLNWYLGNDRSMLLSNCIFRMGGAAVLLS NRSSDRCRSKYQLIHTVRTHKGSDDNAFNCVYQREDNDDNKQIGVSLSKNLMAIAGEALK TNITTLGPLVLPMSEQLLFFATLVARKVFNVKKIKPYIPDFKLAFEHFCIHAGGRAVLDE IEKNLDLSEWHMEPSRMTLNRFGNTSSSSLWYELAYSEAKGRIKRGDRTWQIAFGSGFKC NSAVWRALRTIDPSKEKKKKTNPWIDEIHEFPVPVPRTSPVTSSSESR
Uniprot No.

Target Background

Function
Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 17 (KCS17) mediates the synthesis of very-long-chain fatty acids (VLCFAs) with carbon chain lengths ranging from 22 to 26 (e.g., C22, C24, C26). It is involved in the elongation of C20 fatty acid suberin precursors. KCS17 exhibits functional redundancy with KCS20 in the two-carbon elongation of C22 fatty acids, a process crucial for cuticular wax and root suberin biosynthesis.
Gene References Into Functions
  1. DAISY (involved in suberin biosynthesis) is transcriptionally activated by NaCl application, polyethylene glycol-induced drought stress, and wounding. PMID: 18786002
Database Links

KEGG: ath:AT1G04220

UniGene: At.20865

Protein Families
Chalcone/stilbene synthases family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in siliques, flowers and stems. In young seedlings, expressed in the central cylinder of primary roots, in emerging lateral roots and in their root cap, but not in aboveground tissues such as hypocotyls, cotyledons and leaves. Expressed in sepal

Q&A

Basic Research Questions

  • What is the primary function of KCS17 in Arabidopsis thaliana?

KCS17 is a 3-ketoacyl-CoA synthase that catalyzes the condensation of C2 units from malonyl-CoA to acyl-CoA, representing the first rate-limiting step in very long-chain fatty acid (VLCFA) synthesis. Specifically, KCS17 catalyzes the elongation of C22-C24 VLCFAs required for synthesizing seed coat suberin in Arabidopsis thaliana . This enzyme belongs to the KCS multigene family, which in Arabidopsis comprises 21 members that determine substrate specificity in VLCFA elongation pathways .

  • Where is KCS17 primarily expressed in Arabidopsis thaliana?

Histochemical analysis of Arabidopsis plants expressing GUS (β-glucuronidase) under the control of the KCS17 promoter revealed predominant expression in specific plant tissues. KCS17 shows tissue-specific expression patterns primarily in:

  • Seed coats (particularly in the outer integument1)

  • Petals

  • Stigma

  • Developing pollen

Unlike many KCS family members that are expressed across various vegetative tissues, KCS17 is one of only three KCS genes (along with KCS7 and KCS18) that are expressed specifically in flowers and siliques .

  • What is the subcellular localization of KCS17?

The KCS17:eYFP (enhanced yellow fluorescent protein) signal was detected in the endoplasmic reticulum (ER) of tobacco epidermal cells . This ER localization is consistent with other members of the KCS family, as the ER is the primary site of VLCFA biosynthesis in plants. The proper targeting of KCS enzymes to the ER is critical for their integration into the fatty acid elongase complex and their subsequent functionality .

Intermediate Research Questions

  • How does KCS17 affect VLCFA composition in Arabidopsis seed coats?

KCS17 has a significant impact on the VLCFA composition in Arabidopsis seed coats, with distinct patterns observed in knockout mutants:

VLCFA TypeChange in kcs17 MutantsMagnitude of Change
C22 VLCFAsIncreased~2-fold increase
C22 primary alcoholsIncreased~2-fold increase
C22 α,ω-alkane diolsIncreased~2-fold increase
C22 ω-hydroxy fatty acidsIncreased~2-fold increase
C24 VLCFAsDecreased~50% reduction
C24 ω-hydroxy fatty acidsDecreased~50% reduction
C24 α,ω-dicarboxylic acidsDecreased~50% reduction

These compositional changes in kcs17-1 and kcs17-2 seed coats relative to wild type suggest that KCS17 specifically promotes the elongation of C22 to C24 VLCFAs, and when this function is disrupted, C22 VLCFAs accumulate while C24 derivatives decline .

  • What phenotypic changes are observed in kcs17 mutants?

Several phenotypic changes are observed in kcs17 mutant plants compared to wild type:

  • Decreased autofluorescence of the seed coat under UV light

  • Increased permeability of the seed coat to tetrazolium salt

  • Delayed seed germination under salt and osmotic stress conditions

  • Impaired seedling establishment under stress conditions

  • How does KCS17 interact with other proteins in the fatty acid elongation complex?

KCS17 forms specific protein-protein interactions within the fatty acid elongation complex:

ProteinInteraction with KCS17Function
KCR1Forms homo- and hetero-interactions3-ketoacyl-CoA reductase in VLCFA synthesis
PAS2Forms homo- and hetero-interactions3-hydroxyacyl-CoA dehydratase in VLCFA synthesis
ECRForms homo- and hetero-interactionsEnoyl-CoA reductase in VLCFA synthesis
PAS1No interaction detectedImmunophilin-like protein involved in VLCFA synthesis
KCS17 (self)Forms homo-interactionsSelf-association possibly for complex formation

These interaction patterns suggest that KCS17 functions as part of a multiprotein complex for VLCFA elongation, working cooperatively with KCR1, PAS2, and ECR, but not with PAS1 .

Advanced Research Questions

  • How can recombinant KCS17 be effectively expressed and purified for biochemical studies?

For effective recombinant expression and purification of Arabidopsis thaliana KCS17:

  • Expression System Selection:

    • E. coli: Can be used but often results in inclusion bodies due to membrane protein nature

    • Yeast (S. cerevisiae): Preferred system due to presence of endogenous fatty acid elongation machinery

    • N. benthamiana: Effective for transient expression of plant membrane proteins

  • Construct Design:

    • Include a strong promoter (GAL1 for yeast, 35S for plants)

    • Add an N-terminal tag (His6 or GST) with a flexible linker

    • Ensure proper ER targeting sequence or fusion with an ER-targeting protein

  • Expression Conditions:

    • For yeast: Express at 30°C in induction media (2% galactose) for 12-16 hours

    • For N. benthamiana: Infiltrate with Agrobacterium harboring the construct and harvest after 48-72 hours

  • Purification Strategy:

    • Solubilize membranes with mild detergents (0.5-1% DDM or DMNG)

    • Perform affinity chromatography using tag-specific resins

    • Consider size exclusion chromatography as a final purification step

  • Activity Assessment:

    • Measure elongase activity using radiolabeled substrates (e.g., [14C]malonyl-CoA)

    • Analyze fatty acid profiles by GC-MS after transesterification

    • Perform substrate specificity assays using different chain length acyl-CoAs

When heterologously expressed in appropriate systems, KCS17 should exhibit catalytic activity toward C22 acyl-CoA substrates, resulting in the production of C24 VLCFAs.

  • What are the most effective methods for characterizing KCS17 substrate specificity?

Comprehensive characterization of KCS17 substrate specificity requires a multi-method approach:

  • In vitro Enzymatic Assays:

    • Prepare recombinant KCS17 from yeast or E. coli expression systems

    • Set up reaction mixtures containing purified KCS17, various chain-length acyl-CoA substrates (C16-C24), [14C]malonyl-CoA, and cofactors

    • Analyze reaction products using thin-layer chromatography or HPLC

    • Determine kinetic parameters (Km, Vmax) for different substrates

  • Yeast Complementation Studies:

    • Express KCS17 in Δelo3 yeast strain (lacking endogenous C22-C24 elongation activity)

    • Analyze VLCFA profiles using GC-MS after fatty acid extraction and methyl esterification

    • Compare with other characterized KCS enzymes as controls

  • Transient Expression in Plant Systems:

    • Express KCS17 in Nicotiana benthamiana leaves via Agrobacterium-mediated transformation

    • Analyze changes in the leaf VLCFA profile 3-5 days post-infiltration

    • Compare with wild-type N. benthamiana and plants expressing other KCS proteins

  • Lipidomic Analysis of Arabidopsis Mutants:

    • Compare VLCFA profiles of wild-type and kcs17 knockout plants

    • Analyze specific lipid classes (waxes, suberins, membrane lipids)

    • Use LC-MS/MS for detailed characterization of lipid species

Based on published data, this methodological approach reveals that KCS17 primarily catalyzes the elongation of C22 VLCFAs to C24 VLCFAs, with potential secondary activity toward other chain lengths .

  • How do environmental stressors affect KCS17 expression and function?

Environmental stressors significantly modulate KCS17 expression and function through complex regulatory mechanisms:

  • Light and Temperature Regulation:

    • Unlike some KCS family members (KCS4, KCS5, KCS9, KCS20) that are upregulated under light conditions and downregulated in darkness, KCS17 shows a distinct expression pattern

    • Expression is induced under specific stress conditions, particularly those affecting seed viability

  • Salt and Osmotic Stress Response:

    • KCS17 function becomes crucial during salt and osmotic stress

    • kcs17 mutants show delayed seed germination and impaired seedling establishment under these stress conditions

    • This suggests KCS17-mediated VLCFA synthesis contributes to stress resilience in seeds

  • Regulatory Network Analysis:

    • KCS17 expression is likely controlled by transcription factors responding to developmental and environmental cues

    • GUS reporter studies show tissue-specific expression patterns that may be modulated by stress conditions

    • Interaction partners (KCR1, PAS2, ECR) may be co-regulated under stress conditions

  • Molecular Mechanisms:

    • Stress-induced changes in lipid composition may trigger compensatory changes in KCS17 activity

    • Salt stress typically increases suberin deposition, which requires enhanced VLCFA synthesis

    • KCS17-mediated changes in seed coat composition affect permeability and stress resistance

This regulatory complexity suggests that KCS17 functions as part of a stress-responsive lipid remodeling system that contributes to plant adaptation to environmental challenges .

  • How does KCS17 contribute to seed coat suberin synthesis compared to other KCS family members?

KCS17 plays a specialized role in seed coat suberin synthesis that distinguishes it from other KCS family members:

  • Comparative Expression Patterns:

KCS Family MemberPrimary Expression SitesKey SubstratesPrimary Function
KCS17Seed coat, petals, stigma, pollenC22→C24Seed coat suberin synthesis
KCS2/DAISYRoot endodermisC20→C22/C24Root suberin synthesis
KCS20Root endodermisC20→C22/C24Root suberin synthesis
KCS1Vegetative tissuesC20→C22Wax biosynthesis
KCS6/CER6EpidermisC24→C28Cuticular wax synthesis
KCS18/FAE1SeedsC18→C20/C22Seed oil synthesis
  • Distinct Biochemical Role:

    • KCS17 specifically catalyzes the elongation of C22 to C24 VLCFAs in seed coat suberin

    • This contrasts with KCS2/DAISY and KCS20, which produce similar VLCFAs but primarily in root tissues

    • Unlike KCS18/FAE1, which affects seed oil composition, KCS17 does not impact the fatty acid chain length ratio (CLR) in seed oils

  • Structural Adaptations:

    • Phylogenetic analysis places KCS17 in a distinct clade within the KCS family

    • Structural features likely optimize substrate binding for C22 acyl-CoAs

    • These adaptations contribute to tissue-specific VLCFA synthesis

  • Evolutionary Significance:

    • The specialized function of KCS17 in seed coat suberin synthesis represents an evolutionary adaptation

    • This specialization allows precise control of seed coat permeability and stress resistance

    • Different KCS enzymes likely evolved to fulfill tissue-specific functions in VLCFA synthesis

These distinctions highlight how KCS17 has evolved a specialized role in seed coat suberin synthesis compared to other KCS family members that function in different tissues or produce different chain length VLCFAs .

  • What are the most reliable methods for generating and validating KCS17 mutants in Arabidopsis?

Generating and validating KCS17 mutants requires careful methodology to ensure reliable phenotypic and functional analysis:

  • T-DNA Insertion Mutagenesis:

    • Obtain established T-DNA insertion lines (e.g., kcs17-1, kcs17-2) from stock centers

    • Confirm homozygosity by PCR genotyping using gene-specific and T-DNA border primers

    • Verify disruption of gene expression by RT-PCR or qRT-PCR

    • Example validation: "RT-PCR analysis revealed that full-length kcs17 mRNA was undetectable in kcs17-1 plants whereas it was detected in kcs17-2 plants"

  • CRISPR-Cas9 Targeted Mutagenesis:

    • Design guide RNAs targeting conserved regions of KCS17, particularly the catalytic domain

    • Use plant-optimized CRISPR-Cas9 vectors with appropriate promoters

    • Screen transformants by sequencing to identify frameshift or nonsense mutations

    • Generate homozygous mutant lines through segregation

  • RNAi-Mediated Knockdown:

    • Design RNAi constructs targeting unique regions of KCS17 to avoid off-target effects

    • Use tissue-specific or inducible promoters for conditional knockdown

    • Verify knockdown efficiency by qRT-PCR (target >80% reduction)

    • Complement with truncated endogenous promoter:KCS17 constructs to confirm specificity

  • Validation Methodology:

    Molecular Validation:

    • RT-PCR and qRT-PCR to confirm reduction/absence of transcript

    • Western blot with KCS17-specific antibodies to verify protein loss

    • Sequence verification of mutation sites

    Biochemical Validation:

    • Lipid profiling focusing on C22 and C24 VLCFAs and derivatives

    • Analyze seed coat suberin composition by GC-MS

    • Measure changes in suberin monomers quantitatively

    Phenotypic Validation:

    • Seed coat permeability tests using tetrazolium salt

    • UV autofluorescence microscopy of seed coats

    • Germination assays under normal and stress conditions

    • Seedling establishment rates under salt/osmotic stress

  • Complementation Studies:

    • Transform validated mutants with wild-type KCS17 under native promoter

    • Include reporter tag (e.g., eYFP) for visualization of expression

    • Verify restoration of wild-type VLCFA profiles and phenotypes

    • Use site-directed mutagenesis to create catalytically inactive versions as controls

These methods collectively ensure that the observed phenotypes are specifically attributed to KCS17 disruption rather than off-target effects or background mutations .

  • How can the protein-protein interactions of KCS17 be effectively studied in the context of the fatty acid elongation complex?

Studying KCS17 protein-protein interactions within the fatty acid elongation complex requires specialized techniques for membrane protein research:

  • In vivo Techniques:

    Bimolecular Fluorescence Complementation (BiFC):

    • Fuse KCS17 and potential interactors to complementary YFP fragments

    • Express in tobacco leaves via Agrobacterium infiltration

    • Visualize reconstituted fluorescence using confocal microscopy

    • Analyze ER localization pattern to confirm physiological relevance

    Förster Resonance Energy Transfer (FRET):

    • Create KCS17-CFP and partner-YFP fusion constructs

    • Co-express in plant cells and measure energy transfer efficiency

    • Calculate FRET efficiency to determine proximity and interaction strength

    • Use acceptor photobleaching to confirm specific interactions

    Co-immunoprecipitation in planta:

    • Express epitope-tagged KCS17 in Arabidopsis under native promoter

    • Solubilize membranes with mild detergents (0.5-1% digitonin or DDM)

    • Perform pull-down with anti-tag antibodies

    • Identify interacting partners by mass spectrometry

  • In vitro Approaches:

    Split-Ubiquitin Yeast Two-Hybrid:

    • Clone KCS17 as bait fused to C-terminal ubiquitin fragment

    • Screen against prey library fused to N-terminal ubiquitin fragment

    • Identify positive interactions through reporter gene activation

    • Validate with individual constructs for KCR1, PAS2, ECR, and other candidates

    Isothermal Titration Calorimetry (ITC):

    • Purify recombinant KCS17 and potential binding partners

    • Measure heat changes during binding to quantify interaction parameters

    • Determine stoichiometry, binding affinity, and thermodynamic parameters

    • Evaluate effects of substrates and cofactors on interactions

  • Structural Biology Methods:

    Cryo-Electron Microscopy:

    • Purify intact fatty acid elongase complexes containing KCS17

    • Analyze structural arrangement of subunits within the complex

    • Determine interaction interfaces at near-atomic resolution

    • Map mutations affecting complex assembly or function

    Cross-linking Mass Spectrometry:

    • Apply chemical cross-linkers to stabilize transient interactions

    • Digest complexes and identify cross-linked peptides by MS/MS

    • Map interaction sites based on cross-linked residues

    • Create spatial restraints for molecular modeling

  • Computational Approaches:

    Molecular Dynamics Simulations:

    • Build KCS17 structural model using homology modeling

    • Simulate interactions with known partners in membrane environment

    • Identify stable interaction interfaces and key residues

    • Validate predictions by site-directed mutagenesis

For KCS17 specifically, these approaches have revealed interactions with KCR1, PAS2, and ECR but not with PAS1, suggesting a specific subcomplex formation within the fatty acid elongation machinery .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.