Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 1 (KCS1)

Shipped with Ice Packs
In Stock

Description

Introduction

Arabidopsis thaliana 3-ketoacyl-CoA synthase 1 (KCS1) is a vital enzyme involved in the synthesis of very long-chain fatty acids (VLCFAs) in plants . KCS1 plays a crucial role in plant responses to cold stress . It is involved in wax biosynthesis and is highly expressed in leaves .

Gene and Protein Structure

KCS1 is a member of the fatty acid elongase complex . The Arabidopsis KCS family consists of 21 members . KCS1 encodes a 3-ketoacyl-CoA synthase, which contributes to both cuticular wax and suberin biosynthesis . It participates in both decarbonylation and acyl-reduction wax synthesis pathways .

Function and Role in VLCFA Synthesis

KCS1 is essential for producing saturated and unsaturated VLCFAs, specifically those with chain lengths of up to 22 carbon atoms . The enzyme's activity is crucial for incorporating fatty acid chains into seed triacylglycerols, depending on its substrate specificity . Studies involving the expression of KCS1 in Saccharomyces cerevisiae cells have highlighted its significant role in synthesizing C20:0, C20:1, and C22:0 fatty acids .

Interaction with AKR2A

AKR2A interacts with KCS1 to affect VLCFA biosynthesis in Arabidopsis . The interaction between AKR2A and KCS1 has been demonstrated through yeast-2-hybrid and bimolecular fluorescence complementation (BIFC) assays, showing that the transmembrane motif of KCS1 interacts with the PEST motif of AKR2A both in vitro and in vivo . When KCS1 is overexpressed in akr2a mutants, it can rescue the mutant phenotypes, including chilling sensitivity and decreased VLCFA content .

Impact on Chilling Tolerance

KCS1 influences a plant's chilling tolerance . The expression levels of KCS genes, including KCS1, are affected by cold treatment, with KCS1 expression significantly reduced under chilling stress . Overexpression of KCS1 in akr2a mutants enhances chilling tolerance . Transgenic plants co-overexpressing AKR2A and KCS1 exhibit greater chilling tolerance than plants overexpressing AKR2A or KCS1 alone, as well as wild-type plants .

Expression Analysis

Real-time PCR and western blot assays have been used to study KCS1 expression . While real-time PCR results showed that the transcriptional level of KCS1 was not significantly affected in akr2a-TILLING mutants, western blot assays revealed that the KCS1 expression level was reduced in these mutants, suggesting that AKR2A affects KCS1 expression at the protein level .

Effects of KCS1 Deletion

Deletion of KCS1 can result in a significant reduction in wax components. Specifically, the deletion of KCS1 can lead to the loss of up to 80% of C26 to C30 wax alcohols and aldehydes .

Role in Flowering Process

AKR2A, which interacts with KCS1, is also involved in the flowering process of Arabidopsis thaliana .

Quantitative Analysis of Fatty Acid Composition

Fatty Acid Composition (mol%)C14:0C16:0C16:1C18:0C18:1C18:2C18:3C20:0C20:3
Data not provided

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
KCS1; EL1; At1g01120; T25K16.11; 3-ketoacyl-CoA synthase 1; KCS-1; Very long-chain fatty acid condensing enzyme 1; VLCFA condensing enzyme 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-528
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
KCS1
Target Protein Sequence
MERTNSIEMDRERLTAEMAFRDSSSAVIRIRRRLPDLLTSVKLKYVKLGLHNSCNVTTIL FFLIILPLTGTVLVQLTGLTFDTFSELWSNQAVQLDTATRLTCLVFLSFVLTLYVANRSK PVYLVDFSCYKPEDERKISVDSFLTMTEENGSFTDDTVQFQQRISNRAGLGDETYLPRGI TSTPPKLNMSEARAEAEAVMFGALDSLFEKTGIKPAEVGILIVNCSLFNPTPSLSAMIVN HYKMREDIKSYNLGGMGCSAGLISIDLANNLLKANPNSYAVVVSTENITLNWYFGNDRSM LLCNCIFRMGGAAILLSNRRQDRKKSKYSLVNVVRTHKGSDDKNYNCVYQKEDERGTIGV SLARELMSVAGDALKTNITTLGPMVLPLSEQLMFLISLVKRKMFKLKVKPYIPDFKLAFE HFCIHAGGRAVLDEVQKNLDLKDWHMEPSRMTLHRFGNTSSSSLWYEMAYTEAKGRVKAG DRLWQIAFGSGFKCNSAVWKALRPVSTEEMTGNAWAGSIDQYPVKVVQ
Uniprot No.

Target Background

Function
This protein contributes to cuticular wax and suberin biosynthesis, participating in both decarbonylation and acyl-reduction wax synthesis pathways. It functions as an elongase condensing enzyme, exhibiting high activity with saturated fatty acids, particularly 16:0, 16:1, 18:0, and 20:0. This enzyme mediates the synthesis of very-long-chain fatty acids (VLCFAs) ranging from 20 to 26 carbons in length (e.g., C20:1, C20, C22, C24, and C26).
Database Links

KEGG: ath:AT1G01120

STRING: 3702.AT1G01120.1

UniGene: At.22667

Protein Families
Chalcone/stilbene synthases family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous. Expressed in siliques, flowers, leaves and stems. Barely detected in roots.

Q&A

What is the basic function of KCS1 in Arabidopsis thaliana?

KCS1 encodes a 3-ketoacyl-CoA synthase that functions in very long chain fatty acid synthesis, particularly in vegetative tissues, and plays a crucial role in wax biosynthesis . As part of the fatty acid elongase (FAE) complex, KCS1 catalyzes the first and rate-limiting step in fatty acid elongation, specifically the condensation reaction that adds 2-carbon units to growing acyl chains . The enzyme shows high sequence identity to FAE1, another well-characterized elongase in Arabidopsis, but has distinct tissue expression patterns and substrate preferences .

What is the structural organization of the KCS1 protein?

The KCS1 protein is characterized by two adjacent N-terminal, membrane-spanning domains that anchor it to the endoplasmic reticulum membrane . The full-length protein consists of 528 amino acids and includes characteristic motifs found in 3-ketoacyl-CoA synthases . Sequence analysis reveals that these transmembrane domains are essential for both proper protein localization and enzymatic function . The transmembrane motif has also been identified as the interaction site with other proteins such as AKR2A, which plays a role in cold stress responses .

What chain-length specificity does KCS1 exhibit in VLCFA synthesis?

KCS1 primarily catalyzes the elongation of fatty acids to produce saturated and monounsaturated C20 and C22 VLCFAs . This specificity was determined through heterologous expression in engineered yeast systems where the native elongase components were replaced with Arabidopsis counterparts . The enzyme contributes significantly to the production of wax components, particularly C26 to C30 wax alcohols and aldehydes, with knockout mutants showing up to 80% reduction in these compounds .

How can I effectively express and purify recombinant KCS1 for in vitro assays?

For successful expression and purification of functional recombinant KCS1, a strategic approach targeting membrane protein expression systems is essential. Begin by cloning the KCS1 coding sequence into an expression vector with a strong promoter (e.g., ADH1 for yeast expression) . Consider adding a purification tag (His, GST, or FLAG) that won't interfere with the N-terminal transmembrane domains. For bacterial expression, use strains optimized for membrane proteins (e.g., C41/C43 DE3). For yeast expression, strains like InvSc1 have proven successful .

Purification should employ mild detergents (DDM or LDAO) to solubilize the membrane-anchored protein. Upon purification, store the recombinant protein in Tris-based buffer with 50% glycerol at -20°C to maintain stability . Avoid repeated freeze-thaw cycles, and prepare working aliquots for storage at 4°C for up to one week . Verify purification success and protein integrity using SDS-PAGE and Western blotting with KCS1-specific antibodies.

What are effective methods to assess KCS1 enzymatic activity in vitro?

To assess KCS1 enzymatic activity, microsomal membrane preparations provide a more physiologically relevant context than isolated proteins. Prepare microsomes from either recombinant yeast expressing KCS1 or plant tissues and measure condensation activity using radiolabeled substrates . A typical assay includes:

  • Isolate microsomal fractions through differential centrifugation

  • Incubate microsomes with [14C]-labeled acyl-CoA substrates of various chain lengths

  • Add malonyl-CoA as the 2-carbon donor

  • Incubate at 30°C for 30-60 minutes

  • Extract lipids and separate by thin-layer chromatography

  • Quantify product formation through autoradiography or scintillation counting

Chain-length specificity can be determined by comparing activity with substrates ranging from C16 to C24. For inhibition studies, include elongase inhibitors like flufenacet or MON-0585 at varying concentrations .

How can I generate and characterize KCS1 mutants to study its function?

T-DNA insertion mutants have proven effective for studying KCS1 function in planta . To generate your own KCS1 mutants:

  • Select T-DNA insertion lines from repositories (ABRC, NASC) with insertions in different regions of the gene

  • Confirm homozygosity through genotyping PCR with gene-specific and T-DNA border primers

  • Verify loss of expression through RT-PCR and Western blotting

  • For targeted mutations, employ CRISPR-Cas9 editing to create specific alterations in functional domains

For phenotypic characterization:

  • Examine stem thickness and mechanical strength

  • Test resistance to low humidity stress at different developmental stages

  • Analyze wax composition through gas chromatography-mass spectrometry (GC-MS)

  • Measure VLCFA content in different tissues using fatty acid methyl ester (FAME) analysis

Complete loss of KCS1 expression typically results in significant decreases (up to 80%) in C26-C30 wax alcohols and aldehydes, with less pronounced effects on major wax components like C29 alkanes and ketones .

How does KCS1 interact with other components of the fatty acid elongase complex?

KCS1 functions as part of a multienzyme complex with three core components (KCR, HCD, and ECR) that together catalyze the complete elongation cycle. While KCS determines chain-length specificity, the other components have broader substrate preferences and are shared among different elongase complexes . To study these interactions:

  • Employ split-ubiquitin or membrane-based yeast two-hybrid assays to detect direct protein-protein interactions

  • Use bimolecular fluorescence complementation (BiFC) to visualize interactions in planta

  • Perform co-immunoprecipitation with tagged versions of complex components

  • Create an engineered yeast system where native elongase components are replaced with Arabidopsis counterparts using CRISPR-Cas9 genome editing

The TRIPLE and TRIPLE Δelo3 yeast strains, where yeast genes YBR159, PHS1, and TSC13 are replaced with Arabidopsis KCR1, PAS2, and CER10 respectively, provide excellent platforms for studying KCS1 integration into the elongase complex .

What role does KCS1 play in plant stress responses, particularly cold tolerance?

KCS1 contributes significantly to plant stress responses through its role in VLCFA biosynthesis. For cold stress specifically:

  • KCS1 interacts with AKR2A, a protein involved in cold stress response pathways

  • This interaction occurs specifically through the transmembrane motif of KCS1

  • In akr2a mutants, both KCS1 expression and VLCFA content are reduced

  • Overexpression of KCS1 in akr2a mutants enhances VLCFA contents and improves chilling tolerance

To investigate this relationship:

  • Perform cold stress assays comparing wild-type, kcs1 mutants, and KCS1-overexpressing lines

  • Monitor changes in gene expression using qRT-PCR during cold acclimation

  • Measure changes in membrane lipid composition, particularly VLCFAs

  • Use co-immunoprecipitation or proximity labeling to identify cold-specific interaction partners

  • Employ lipidomics to characterize changes in lipid profiles under cold stress conditions

The AKR2A-KCS1 interaction represents a molecular link between cold stress signaling and membrane lipid remodeling that contributes to plant cold tolerance .

How do KCS1-dependent VLCFAs contribute to membrane properties and signaling?

VLCFAs produced by KCS1 contribute to membrane properties through:

  • Incorporation into sphingolipids and phospholipids, affecting membrane fluidity and microdomain formation

  • Production of cuticular waxes that influence water retention and pathogen resistance

  • Generation of signaling molecules that regulate development and stress responses

To investigate these contributions:

  • Use lipidomic approaches to characterize membrane lipid compositions in wild-type and kcs1 mutants

  • Examine membrane fluidity using fluorescence anisotropy or FRAP measurements

  • Isolate lipid microdomains (lipid rafts) and analyze their composition

  • Test permeability and water loss in plants with altered KCS1 expression

Findings indicate that kcs1-1 mutants show thinner stems and reduced resistance to low humidity stress at young ages, suggesting VLCFA-dependent alterations in structural properties and water retention capacity .

How can I overcome functional redundancy issues when studying KCS1?

The Arabidopsis genome contains 21 KCS genes with potentially overlapping functions. To address functional redundancy:

  • Generate multiple mutant combinations using T-DNA insertion lines or CRISPR-Cas9 editing

  • Employ conditional or tissue-specific expression systems to avoid lethality

  • Use the engineered yeast platforms (TRIPLE and TRIPLE Δelo3) that provide clean backgrounds for assessing individual KCS activities

  • Perform complementation assays where different KCS genes are expressed in kcs1 mutant backgrounds

  • Analyze substrate specificities through in vitro assays with purified proteins or microsomes

Research has shown that different KCS enzymes have distinct but overlapping chain-length specificities: KCS1 primarily produces C20 and C22 VLCFAs, while KCS5 and KCS6 mainly produce C24 to C28 VLCFAs .

What considerations are important when designing experiments to study KCS1 localization and trafficking?

KCS1 is a membrane-anchored protein with specific localization requirements. When studying its localization and trafficking:

  • Use fluorescent protein fusions cautiously, ensuring tags don't interfere with the N-terminal membrane-spanning domains

  • Consider C-terminal fusions or internal tagging strategies

  • Validate localization using multiple approaches (fluorescence microscopy, subcellular fractionation, immunogold labeling)

  • Examine co-localization with known ER markers and other FAE components

  • Study trafficking dynamics using photoconvertible fluorescent proteins or FRAP

For protein-protein interactions affecting localization, investigate the role of AKR2A, which interacts with the transmembrane motif of KCS1 and may influence its proper targeting .

How can contradictory results in KCS1 activity assays be reconciled?

Contradictory results in KCS1 activity assays may arise from differences in experimental systems. To reconcile such differences:

  • Compare heterologous expression systems systematically (yeast, E. coli, insect cells)

  • Test activity in both wild-type yeast and engineered strains lacking competing elongases (e.g., TRIPLE Δelo3)

  • Examine substrate availability and competition in different systems

  • Consider post-translational modifications that may differ between systems

  • Control for protein expression levels and proper membrane integration

Research has shown that some plant KCS enzymes show no activity in wild-type yeast but function in engineered systems like TRIPLE Δelo3, highlighting the importance of the expression platform .

What emerging technologies could advance our understanding of KCS1 function?

Several emerging technologies hold promise for KCS1 research:

  • Cryo-electron microscopy for structural determination of the entire FAE complex

  • Mass spectrometry-based proximity labeling (BioID, APEX) to identify transient interaction partners

  • Lipidomics approaches to comprehensively profile VLCFA-containing lipids

  • Single-cell transcriptomics to identify cell-specific expression patterns

  • Synthetic biology approaches to reconstitute minimal functional FAE systems

  • Gene editing technologies to create precise mutations in functional domains

These approaches could provide unprecedented insights into the structural organization, dynamic interactions, and tissue-specific functions of KCS1 and the FAE complex.

How might KCS1 research inform biotechnological applications in crop improvement?

Understanding KCS1 function has several potential applications in crop improvement:

  • Engineering drought and cold tolerance through modulation of VLCFA content in protective waxes

  • Improving water use efficiency by enhancing cuticular wax production

  • Developing crops with altered oil composition for industrial or nutritional applications

  • Creating plants with enhanced resistance to pests and pathogens through modified surface properties

The interaction between KCS1 and AKR2A represents a promising target for engineering enhanced cold tolerance in crops, as overexpression of KCS1 has been shown to improve chilling tolerance in Arabidopsis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.