Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 5 (KCS5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KCS5; CER60; At1g25450; F2J7.9; 3-ketoacyl-CoA synthase 5; KCS-5; Very long-chain fatty acid condensing enzyme 5; VLCFA condensing enzyme 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-492
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
KCS5
Target Protein Sequence
MSDFSSSVKLKYVKLGYQYLINNFLTLLLIPVIATVAIELLRMGPEEILSVLNSLHFELL HILCSSFLIIFVSTVYFMSKPRTVYLVDYSCYKPPVTCRVPFSSFMEHSRLILKDNPKSV EFQMRILERSGLGEETCLPPAIHYIPPTPTMESARNEAQMVIFTAMEDLFKNTGLKPKDI DILIVNCSLFSPTPSLSAMIINKYKLRSNIKSYNLSGMGCSASLISVDVARDLLQVHPNS NAIIISTEIITPNYYKGNERAMLLPNCLFRMGGAAILLSNRRSDRWRAKYKLCHLVRTHR GADDKSYNCVMEQEDKNGNVGINLSKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSL IGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGN TSSSSLWYELSYIEAQGRMKRNDRVWQIAFGSGFKCNSAVWKCNRTIKTPTDGAWSDCIE RYPVFIPEVVKL
Uniprot No.

Target Background

Function

Mediates primarily the synthesis of very-long-chain fatty acids (VLCFAs) ranging from 26 to 30 carbons in length (e.g., C20:1, C26, C28, C30).

Database Links

KEGG: ath:AT1G25450

STRING: 3702.AT1G25450.1

UniGene: At.48237

Protein Families
Chalcone/stilbene synthases family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in siliques, flowers, leaves and seedlings.

Q&A

What is 3-ketoacyl-CoA synthase 5 (KCS5) and what is its role in Arabidopsis thaliana?

KCS5 (3-ketoacyl-CoA synthase 5) is a key enzyme involved in the synthesis of very long chain fatty acids (VLCFAs) in Arabidopsis thaliana. It functions as part of the fatty acid elongase (FAE) complex, specifically catalyzing the first and rate-limiting step of fatty acid elongation. The enzyme plays a crucial role in the synthesis of cuticular waxes, which form the protective barrier on plant surfaces. KCS5 is encoded by the At1g25450 gene and is also known as CER60 .

The primary function of KCS5 is to catalyze the condensation reaction during fatty acid elongation, determining the chain-length substrate specificity. This enzyme contributes to the synthesis of VLCFAs that are essential components of cuticular waxes, which protect plants from water loss, UV radiation, and pathogen attacks. Research has shown that KCS5 plays a significant role in plant developmental processes and stress responses .

Interestingly, KCS5 has been established as a close paralog of KCS6 in Arabidopsis thaliana, although they have non-redundant functions. The segmental duplication responsible for the origin of this KCS6-KCS5 paralogy is exclusive to the Brassicaceae family, suggesting a specialized evolutionary adaptation in this plant family .

How does DNA methylation affect KCS5 transcriptional regulation?

DNA methylation plays a significant role in the transcriptional regulation of KCS5, as evidenced by experimental approaches using DNA methylation inhibitors. When KCS5 promoter activity was studied using transcriptional fusion constructs, treatment with 5-Azacytidine (a DNA methylation inhibitor) resulted in altered promoter activity. This observation strongly suggests that DNA methylation patterns within the KCS5 promoter region influence its transcriptional output .

The mechanism likely involves the methylation of cytosine residues within the promoter region, which can affect the binding of transcription factors and other regulatory proteins. Methylated regions often recruit methyl-CpG-binding domain proteins and associated chromatin remodeling complexes, leading to the formation of repressive chromatin structures that inhibit transcription. Conversely, demethylation can create a more accessible chromatin environment that facilitates transcription factor binding and gene expression .

The specific methylation patterns in the KCS5 promoter may vary across different tissues, developmental stages, and in response to environmental stimuli, providing a mechanism for context-specific regulation of KCS5 expression. This epigenetic layer of regulation adds complexity to the transcriptional control of KCS5 beyond the sequence-specific binding of transcription factors .

This finding represents a significant advancement in our understanding of KCS5 regulation, as it reveals an epigenetic mechanism that may play a crucial role in modulating KCS5 expression in response to developmental cues and environmental changes. Future research combining bisulfite sequencing to map methylation patterns with functional studies would further elucidate the detailed mechanisms of how DNA methylation affects KCS5 expression in different contexts.

What is the functional significance of the 87 bp intronic fragment retained in KCS5 splice variants?

Research has revealed that an 87 bp fragment from the first intron of KCS5 is retained in a splice variant, and this fragment functions as a transcriptional repressor. This finding highlights the complex nature of KCS5 regulation beyond the traditional promoter-based control mechanisms .

The functional significance of this intronic fragment includes several aspects:

  • Transcriptional repression: The retained intronic sequence acts as a negative regulatory element, potentially binding repressor proteins or forming secondary structures that inhibit transcription. This provides an additional layer of control over KCS5 expression levels .

  • Alternative splicing regulation: The presence of this retained intron in certain splice variants suggests that alternative splicing plays a role in modulating KCS5 expression. Different splice variants may be produced in response to specific developmental or environmental cues, allowing for context-specific expression patterns .

  • Evolutionary significance: The conservation or divergence of this intronic regulatory element across related species could provide insights into the evolution of KCS5 regulation in different Brassicaceae members .

This discovery of an intronic regulatory element in KCS5 represents an important contribution to our understanding of gene regulation mechanisms in plants. It suggests that similar regulatory elements might exist in other genes involved in fatty acid metabolism and cuticular wax synthesis, potentially representing a broader regulatory strategy in these pathways .

How does KCS5 contribute to plant drought stress tolerance?

KCS5 contributes significantly to plant drought stress tolerance through its role in cuticular wax biosynthesis. As a key enzyme in the fatty acid elongase (FAE) complex, KCS5 catalyzes the production of very long chain fatty acids (VLCFAs) that serve as precursors for cuticular wax components. These waxes form a hydrophobic barrier on plant surfaces that helps reduce non-stomatal water loss, a critical adaptation for surviving drought conditions .

Research examining the relationship between KCS genes and drought stress tolerance has shown that proper functioning of these enzymes, including KCS5, is essential for developing an effective cuticular barrier. Reverse genetic models in Arabidopsis thaliana for KCS5 have exhibited altered tolerance to abiotic stress, including drought, highlighting the importance of this enzyme in stress adaptation mechanisms .

The specific contribution of KCS5 to drought tolerance likely involves several mechanisms:

  • Regulation of cuticular permeability: By influencing the composition and quantity of cuticular waxes, KCS5 activity affects the permeability of the cuticle to water vapor. Optimal KCS5 function results in a wax composition that effectively reduces water loss through the cuticle during drought conditions .

  • Adaptive responses to water deficit: Under drought stress, plants may modulate KCS5 expression and activity to adjust their cuticular wax composition, enhancing their water retention capacity. This represents an important adaptive response to water deficit conditions .

  • Interaction with stress signaling pathways: KCS5 expression is likely regulated by stress-responsive transcription factors, as indicated by the presence of stress-responsive motifs in its promoter region. This suggests that KCS5 is integrated into broader stress signaling networks that coordinate plant responses to drought .

Mutations in KCS5 have significant impacts on both plant development and stress responses, reflecting the importance of this enzyme in cuticular wax biosynthesis and the multiple roles of cuticular waxes in plant biology. Reverse genetic models in Arabidopsis thaliana for KCS5 have exhibited altered developmental growth, wax profiles, and tolerance to abiotic stress .

The developmental effects of KCS5 mutations include altered growth patterns, changes in organ development, and modified epidermal characteristics. These effects likely result from changes in cuticular wax composition that affect water relations, temperature regulation, and cell expansion during development .

The effects of KCS5 mutations on stress responses are particularly significant, as they directly impact the plant's ability to withstand environmental challenges. Plants with altered KCS5 function show changes in drought tolerance due to modified cuticular permeability, which affects water retention under water-deficit conditions. Additionally, changes in cuticular wax composition can alter the plant's response to temperature extremes and pathogen attack .

Understanding the specific effects of different types of KCS5 mutations provides valuable insights for both basic research on plant cuticle biology and applied approaches aimed at optimizing cuticular properties for enhanced stress resistance. The non-redundant function of KCS5 compared to its close paralog KCS6 suggests that mutations in KCS5 would have distinct phenotypic effects that cannot be compensated by other KCS enzymes, highlighting its unique contribution to plant development and stress responses .

What are the key knowledge gaps in KCS5 research?

Despite significant advances in understanding KCS5 biology, several important knowledge gaps remain that warrant further investigation. Addressing these gaps would provide a more comprehensive understanding of KCS5 function and regulation, with potential applications in crop improvement for stress resistance.

One significant knowledge gap concerns the detailed molecular mechanisms regulating KCS5 expression under different environmental conditions. While stress-responsive elements have been identified in the KCS5 promoter, the specific transcription factors binding these elements and the signaling pathways leading to their activation remain largely unknown . Similarly, the role of DNA methylation in KCS5 regulation requires further characterization to understand how epigenetic modifications respond to developmental and environmental cues .

Another important area for future research is the biochemical characterization of KCS5 enzyme kinetics with different substrates. While yeast expression studies have provided insights into substrate preferences, detailed enzymological studies with purified recombinant KCS5 would offer more precise understanding of its catalytic properties and substrate specificity .

The interaction of KCS5 with other components of the fatty acid elongase (FAE) complex represents another knowledge gap. Understanding how KCS5 physically and functionally interacts with other enzymes in the complex would provide insights into the coordination of very long chain fatty acid synthesis and potential regulatory mechanisms at the protein level .

Lastly, the potential for manipulating KCS5 to enhance stress tolerance in crop plants requires further investigation. While the search results mention that "investigation of the role of cuticular waxes as a strategy for mitigating stress" is an area requiring further research , translating the fundamental knowledge of KCS5 biology to practical applications in crop improvement remains a significant challenge.

What novel methodologies could advance KCS5 research?

Advancing KCS5 research will require innovative methodologies that provide deeper insights into its function, regulation, and potential applications. Several novel approaches could significantly contribute to our understanding of this important enzyme:

These novel methodologies, combined with existing approaches, would significantly advance our understanding of KCS5 biology and its potential applications in enhancing plant stress tolerance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.