Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 7 (KCS7)

Shipped with Ice Packs
In Stock
Cat. No.
BT2488952
Source
in vitro E.coli expression system
Synonyms
KCS7; At1g71160; F23N20.15; 3-ketoacyl-CoA synthase 7; KCS-7; Very long-chain fatty acid condensing enzyme 7; VLCFA condensing enzyme 7
Quick Inquiry

Description

Introduction to Recombinant Arabidopsis thaliana 3-ketoacyl-CoA Synthase 7 (KCS7)

Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 7 (KCS7) is a recombinant protein derived from the model plant Arabidopsis thaliana. It belongs to the family of 3-ketoacyl-CoA synthases, which are crucial enzymes involved in the elongation of very long-chain fatty acids (VLCFAs). These fatty acids are essential components of plant cuticular waxes, suberins, and sphingolipids, playing vital roles in plant defense against environmental stresses and in maintaining the integrity of plant surfaces.

Function and Role of KCS7

KCS7 is specifically involved in the biosynthesis of VLCFAs, which are precursors for various cuticular wax components. These components help protect plants from water loss and environmental stresses. The enzyme catalyzes the condensation reactions necessary for elongating hydrocarbon chains, contributing to the formation of the plant cuticle.

Characteristics of Recombinant KCS7

  • Product Type: Recombinant protein

  • Species: Arabidopsis thaliana (Mouse-ear cress)

  • Uniprot Number: Q9C992

  • Tag Information: The tag type is determined during the production process.

  • Storage Buffer: Tris-based buffer with 50% glycerol, optimized for this protein.

  • Storage Conditions: Store at -20°C for short-term storage or -80°C for extended storage. Repeated freezing and thawing is not recommended .

Data Table: Characteristics of Recombinant Arabidopsis thaliana KCS7

CharacteristicDescription
Product TypeRecombinant Protein
SpeciesArabidopsis thaliana
Uniprot NumberQ9C992
Tag InformationDetermined during production
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C or -80°C

References:

  1. Characterization of the closely related Arabidopsis thaliana β-ketoacyl-CoA synthases.

  2. Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 7 (KCS7).

  3. UniProt Entry for KCS7.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notification is required for dry ice shipping, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and storing in aliquots at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
KCS7; At1g71160; F23N20.15; 3-ketoacyl-CoA synthase 7; KCS-7; Very long-chain fatty acid condensing enzyme 7; VLCFA condensing enzyme 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-460
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
KCS7
Target Protein Sequence
MESSFHFINEALLITQTFITFHQFLVASACVLIAVFGYYFFKPRCIIYLIDFSCYQPPDF LRAPVSNFIEHLTISGVFDQESLDLQQKILERSGISDDASVPATVHEIPPNASISAAREE THEILFAIVQDLFSKHEIDPKSIDILVSNCSLFCPSPSITSMIINKFGMRSDIKSFSLSG MGCSAGILSVNLVKDLMKIHGDSLALVLSMEAVSPNGYRGKCKSMLIANTIFRMGGAAIL LSNRKQDSHKAKYKLQHIIRTHVGSDTESYESVMQQVDEEGKVGVALSKQLVRVASKALK INVVQLGPRVLPYSEQLKYIISFIQRKWGMHKEIYTPNFKKAFEHFCIHAGGRAIIEGVE KHLKLDKEDVEASRSTLYRYGNTSSSSLWYELQYLEAKGRMKMGDKVWQIGFGSGFKANS AVWKCISEIDSRGRNAWSDRIHLYPVCGDTSSALKTELLS
Uniprot No.
Q9C992

Target Background

Database Links

KEGG: ath:AT1G71160

STRING: 3702.AT1G71160.1

UniGene: At.49516

Protein Families
Chalcone/stilbene synthases family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in flowers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.