Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 8 (KCS8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
KCS8; At2g15090; T15J14.13; 3-ketoacyl-CoA synthase 8; KCS-8; Very long-chain fatty acid condensing enzyme 8; VLCFA condensing enzyme 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-481
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
KCS8
Target Protein Sequence
MKNLKMVFFKILFISLMAGLAMKGSKINVEDLQKFSLHHTQNNLQTISLLLFLVVFVWIL YMLTRPKPVYLVDFSCYLPPSHLKVSIQTLMGHARRAREAGMCWKNKESDHLVDFQEKIL ERSGLGQETYIPEGLQCFPLQQGMGASRKETEEVIFGALDNLFRNTGVKPDDIGILVVNS STFNPTPSLASMIVNKYKLRDNIKSLNLGGMGCSAGVIAVDVAKGLLQVHRNTYAIVVST ENITQNLYLGKNKSMLVTNCLFRVGGAAVLLSNRSRDRNRAKYELVHTVRIHTGSDDRSF ECATQEEDEDGIIGVTLTKNLPMVAARTLKINIATLGPLVLPLKEKLAFFITFVKKKYFK PELRNYTPDFKLAFEHFCIHAGGRALIDELEKNLKLSPLHVEASRMTLHRFGNTSSSSIW YELAYTEAKGRMKEGDRIWQIALGSGFKCNSSVWVALRDVKPSANSPWEDCMDRYPVEID I
Uniprot No.

Target Background

Database Links

KEGG: ath:AT2G15090

STRING: 3702.AT2G15090.1

UniGene: At.13393

Protein Families
Chalcone/stilbene synthases family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in leaves and seedlings.

Q&A

What is KCS8 and what is its functional role in Arabidopsis thaliana?

KCS8 (3-ketoacyl-CoA synthase 8) is a key rate-limiting enzyme in the biosynthesis pathway of very long-chain fatty acids (VLCFAs) in Arabidopsis thaliana. It belongs to the KCS family, which in Arabidopsis consists of 21 members that are classified into different subfamilies based on amino acid sequence homology, duplication history, genomic organization, and protein topology . The primary function of KCS8 is to catalyze the initial condensation reaction in the fatty acid elongation process, which determines the final carbon chain length of VLCFAs. KCS8 is also known as very long-chain fatty acid condensing enzyme 8 (VLCFA condensing enzyme 8) and is encoded by the KCS8 gene located at locus At2g15090 . The enzyme possesses substrate specificity that directly influences the composition of VLCFAs produced in different plant tissues, contributing to various physiological processes including wax biosynthesis, membrane formation, and stress responses.

What are the structural characteristics of KCS8 protein?

The KCS8 protein (UniProt accession: Q4V3C9) is characterized by several important structural features that define its function. The full amino acid sequence consists of 481 amino acids . The protein contains conserved domains characteristic of the 3-ketoacyl-CoA synthase family, including catalytic residues essential for condensation reactions. The amino acid sequence (MKNLKMVFFKILFISLMAGLAMKGSKINVEDLQKFSLHHTQNNLQTISLLLFLVVFVWIL and continuing) reveals hydrophobic regions consistent with its membrane-associated function . Like other KCS family members, KCS8 likely contains transmembrane domains that anchor it to the endoplasmic reticulum membrane where VLCFA elongation occurs. The protein's three-dimensional structure influences its substrate specificity, determining which fatty acyl-CoAs it can efficiently utilize as substrates for chain elongation. This structural organization places KCS8 within the broader context of the KCS family, which is divided into various subclasses including KCS1-like, FDH-like, FAE1-like, and CER6, though the specific subclass of KCS8 must be determined through phylogenetic analysis with other characterized members .

What are the optimal storage and handling conditions for recombinant KCS8 protein?

For optimal stability and activity maintenance of recombinant Arabidopsis thaliana KCS8 protein, specific storage and handling protocols must be followed. The recommended storage conditions include keeping the protein at -20°C for regular storage, and at -80°C for extended preservation periods . The protein is typically provided in a Tris-based buffer containing 50% glycerol, which has been optimized to maintain protein stability . To minimize activity loss through protein degradation, it is crucial to avoid repeated freezing and thawing cycles. Working aliquots can be stored at 4°C for up to one week to avoid this issue . When handling the protein for experimental purposes, researchers should maintain cold chain conditions and use appropriate enzyme buffer systems that match the pH optimum and cofactor requirements of KCS8. Additionally, considering the membrane-associated nature of KCS enzymes, the inclusion of appropriate detergents or lipid environments may be necessary to maintain enzymatic activity in in vitro assays.

What experimental approaches are most effective for studying KCS8 enzymatic function?

Elucidating KCS8 enzymatic function requires a multi-faceted experimental approach combining biochemical, molecular, and genetic techniques. In vitro enzymatic assays represent the foundation for characterizing KCS8 activity, requiring purified recombinant protein (typically with affinity tags) , appropriate acyl-CoA substrates of varying chain lengths, malonyl-CoA as the second substrate, and detection systems for measuring the condensation products. Radioisotope-labeled substrates or LC-MS/MS analysis can quantify the specific products formed. Complementary to in vitro assays, genetic approaches using knockout/knockdown mutants or overexpression lines can reveal KCS8's in vivo function. The analysis should include comprehensive lipid profiling using techniques like GC-MS or LC-MS to determine changes in VLCFA composition across different tissues. For substrate specificity studies, competition assays with multiple acyl-CoA substrates can determine KCS8's preference for specific chain lengths and saturation levels. Additionally, site-directed mutagenesis of conserved catalytic residues and subsequent activity assays can identify crucial amino acids for KCS8 function. To study protein-protein interactions, techniques such as yeast two-hybrid, co-immunoprecipitation, or bimolecular fluorescence complementation can reveal whether KCS8 interacts with other components of the fatty acid elongation complex.

How should researchers design experiments to understand KCS8 expression patterns and regulation?

To comprehensively characterize KCS8 expression patterns and regulatory mechanisms, researchers should implement a multi-level experimental design encompassing transcriptional, translational, and post-translational analyses. At the transcriptional level, quantitative RT-PCR provides precise measurement of KCS8 mRNA abundance across different tissues, developmental stages, and environmental conditions . This should be complemented with promoter-reporter fusion constructs (KCS8promoter:GUS or KCS8promoter:GFP) to visualize spatial expression patterns in planta. RNA-seq analysis can place KCS8 expression within the broader transcriptional landscape and identify co-expressed genes. For promoter analysis, the identification of cis-acting elements through bioinformatic approaches and validation via promoter deletion studies can reveal regulatory mechanisms, as KCS family members often contain elements responsive to developmental cues, hormones, and stresses . At the protein level, immunolocalization studies using KCS8-specific antibodies or translational fusions (KCS8:GFP expressed under its native promoter) can confirm the subcellular localization and tissue-specific accumulation. To identify transcription factors regulating KCS8, yeast one-hybrid screens or chromatin immunoprecipitation (ChIP) assays should be performed. Finally, exploring epigenetic regulation through techniques like bisulfite sequencing or ChIP-seq for histone modifications can provide insights into chromatin-level regulation of KCS8 expression.

How can contradictory findings regarding KCS8 function be reconciled in research?

Reconciling contradictory findings regarding KCS8 function requires systematic investigation of methodological differences, genetic backgrounds, and environmental conditions. First, researchers should conduct a detailed comparison of experimental methodologies, focusing on differences in protein expression systems, assay conditions, substrate concentrations, and detection methods that may influence the observed activity of KCS8. Recombinant protein studies should consider whether different tag types affect enzyme activity, as tag choice can be critical for proper folding and function . For in vivo studies, the genetic background must be carefully considered—differences between ecotypes or the presence of compensatory mechanisms through functional redundancy with other KCS family members may explain discrepancies . Environmental conditions and developmental stages should be standardized, as KCS expression and activity are known to respond to various stimuli including stress conditions . Researchers should also employ multiple complementary techniques to validate findings—for example, combining in vitro biochemical assays with in vivo genetic studies and comprehensive lipid profiling. Statistical power analysis should be performed to ensure appropriate sample sizes for detecting biologically meaningful effects. Finally, when publishing contradictory findings, researchers should explicitly discuss methodological differences from previous studies and propose testable hypotheses to explain the discrepancies, facilitating more targeted follow-up investigations by the scientific community.

What approaches should be used to investigate potential functional redundancy between KCS8 and other KCS family members?

To investigate functional redundancy between KCS8 and other KCS family members, researchers should implement a comprehensive strategy combining phylogenetic, expression, and functional analyses. Initially, a detailed phylogenetic analysis should establish the evolutionary relationships between KCS8 and other KCS enzymes, identifying the most closely related members that might share redundant functions . This should be followed by comparative expression analysis using qRT-PCR or RNA-seq to identify KCS genes with overlapping spatiotemporal expression patterns, as co-expression may indicate functional redundancy . For genetic approaches, researchers should generate single knockout/knockdown lines for KCS8 and other candidate redundant KCS genes, followed by multiple knockout combinations to observe enhanced phenotypes that might not be apparent in single mutants. Complementation experiments, where one KCS gene is expressed under the promoter of another, can directly test functional equivalence. At the biochemical level, in vitro enzyme assays with purified recombinant proteins can compare substrate specificities and kinetic parameters between KCS8 and other KCS enzymes . Comprehensive lipidomic profiling of single and multiple mutants using techniques like LC-MS/MS can reveal changes in VLCFA profiles that indicate shared or distinct functions. Additionally, protein localization studies can determine whether potentially redundant KCS enzymes share the same subcellular localization. This multi-faceted approach will provide a comprehensive understanding of the functional overlap between KCS8 and other KCS family members in Arabidopsis.

How can researchers accurately assess KCS8 enzymatic activity in vitro?

Table 2: Comprehensive Protocol for KCS8 Enzymatic Activity Assay

Assay ComponentRecommended ConditionsConsiderations
Enzyme concentration0.5-5 μg purified proteinTitrate to determine linear range
Buffer system50 mM Tris-HCl, pH 7.5, 1 mM DTTTest pH range 6.5-8.0
Acyl-CoA substrates5-50 μM C16-C22 acyl-CoAsInclude range of chain lengths
Malonyl-CoA50-100 μM (can be 14C-labeled)Critical second substrate
Cofactors1 mM NADH, 1 mM NADPHTest necessity for activity
Detergent0.1% Triton X-100 or 0.05% DDMRequired for membrane protein
Incubation30 min at 30°CDetermine time linearity
Reaction terminationAcidification (HCl) or organic extractionStop reaction completely
Product detectionHPLC, GC-MS, or radiometric detectionQuantify 3-ketoacyl-CoA products
ControlsHeat-inactivated enzyme, no substrateEssential for background correction

Accurately assessing KCS8 enzymatic activity in vitro requires careful consideration of the reaction conditions and detection methods. The reaction mixture should contain purified recombinant KCS8 protein , appropriate acyl-CoA substrates (typically C16-C22 chain lengths), malonyl-CoA as the second substrate, and necessary cofactors. For detection and quantification of enzymatic activity, researchers can employ several methods: (1) Radioisotope assays using 14C-labeled malonyl-CoA, followed by product extraction and quantification via scintillation counting; (2) HPLC or LC-MS/MS analysis of reaction products after appropriate derivatization; (3) Spectrophotometric coupled-enzyme assays that monitor NADH oxidation linked to 3-ketoacyl-CoA formation. When establishing the assay, researchers should determine the linear range with respect to enzyme concentration and reaction time, and optimize buffer conditions including pH, ionic strength, and the presence of activators or inhibitors. Importantly, since KCS8 is a membrane-associated enzyme, the inclusion of appropriate detergents or lipid environments is crucial for maintaining activity. Comprehensive controls must be included: negative controls (heat-inactivated enzyme, omission of substrates) and positive controls (well-characterized KCS enzymes like KCS18/FAE1 if available) . To determine substrate specificity, researchers should test a range of acyl-CoA substrates with different chain lengths and degrees of saturation under competitive conditions.

What are the critical controls needed in KCS8 functional studies?

For rigorous KCS8 functional studies, a comprehensive set of controls is essential to ensure valid and reproducible results. For in vitro enzymatic assays, primary controls include: (1) No-enzyme controls to establish background activity; (2) Heat-inactivated enzyme controls to account for non-enzymatic reactions; (3) Substrate omission controls for each substrate; (4) Positive controls using well-characterized KCS enzymes from Arabidopsis, such as KCS18/FAE1 . For genetic studies involving KCS8 mutants, critical controls include: (1) Multiple independent mutant lines to rule out background mutations; (2) Complementation lines expressing wild-type KCS8 to confirm phenotype causality; (3) Wild-type segregants from the same background; (4) Appropriate ecotype controls matching the genetic background of the mutants . When performing gene expression analyses, researchers should include: (1) Reference genes with stable expression across experimental conditions; (2) No-template and no-reverse transcriptase controls for qRT-PCR; (3) Biological replicates from independent experiments; (4) Technical replicates to assess method variability. For protein localization studies, controls should include: (1) Free fluorescent protein expression to distinguish from fusion protein patterns; (2) Known subcellular markers for co-localization; (3) Western blot validation of fusion protein integrity. Additionally, researchers should implement experimental blinding when possible, particularly for phenotypic analyses, to prevent unconscious bias in data collection and interpretation.

What analytical techniques are most appropriate for studying VLCFA profiles associated with KCS8 activity?

Comprehensive analysis of VLCFA profiles associated with KCS8 activity requires sophisticated analytical techniques that provide both qualitative and quantitative information. Gas chromatography coupled with mass spectrometry (GC-MS) serves as the gold standard for analyzing fatty acid methyl esters (FAMEs) derived from total lipid extracts, offering excellent separation of VLCFAs based on chain length and degree of unsaturation. For more complex lipid analysis, liquid chromatography-tandem mass spectrometry (LC-MS/MS) enables identification and quantification of intact lipid species containing VLCFAs, providing insights into how KCS8 activity affects specific lipid classes. Ultra-high performance liquid chromatography (UHPLC) with charged aerosol detection (CAD) offers high sensitivity for quantifying minor VLCFA-containing lipid species. For spatial distribution studies, matrix-assisted laser desorption/ionization-mass spectrometry imaging (MALDI-MSI) can visualize the tissue-specific localization of VLCFAs. Nuclear magnetic resonance (NMR) spectroscopy provides detailed structural information about VLCFA molecules, including positional isomers. Sample preparation is critical—researchers should employ multiple extraction methods to ensure comprehensive lipid recovery, use appropriate internal standards for accurate quantification, and implement derivatization strategies (typically methylation) compatible with the analytical platform. Data analysis should incorporate multivariate statistical methods to identify subtle changes in VLCFA profiles between wild-type and KCS8 mutant or transgenic plants. These analytical approaches collectively provide a comprehensive view of how KCS8 activity influences VLCFA composition across different tissues and developmental stages.

How does KCS8 function contribute to plant stress responses?

The function of KCS8 in plant stress responses is likely multifaceted, affecting membrane integrity, cuticular wax composition, and signaling lipid production. VLCFAs synthesized through KCS-mediated pathways are essential components of membrane lipids, particularly sphingolipids and phospholipids, which contribute to membrane fluidity and permeability during stress conditions . Research indicates that various KCS family members show differential expression under stress conditions, with KCS4 specifically involved in the accumulation of polyunsaturated TAGs during stress responses . While the specific stress response role of KCS8 remains to be fully characterized, it likely follows similar patterns observed in other KCS family members. The cuticular wax layer, which contains VLCFAs and their derivatives, serves as a critical barrier against water loss, pathogen invasion, and UV radiation. Changes in KCS8 expression or activity under stress conditions could alter cuticular wax composition, affecting plant resistance to drought, pathogens, or radiation stress. Additionally, VLCFAs and their derivatives function as signaling molecules during stress responses, potentially activating stress-responsive gene expression networks. To investigate KCS8's specific contribution to stress responses, researchers should examine changes in KCS8 expression under various stress conditions (drought, salinity, temperature extremes, pathogen attack), analyze stress phenotypes in KCS8 mutants compared to wild-type plants, and perform lipidomic profiling to identify stress-induced changes in VLCFA-containing lipids dependent on KCS8 activity.

What are the implications of KCS8 research for crop improvement strategies?

Research on KCS8 and related KCS enzymes has significant implications for crop improvement strategies targeting enhanced stress tolerance, modified seed oil composition, and improved surface wax properties. Manipulating KCS8 expression or activity could potentially enhance drought tolerance through increased cuticular wax deposition, reducing water loss from aerial surfaces. This application is particularly relevant as research on other KCS family members has demonstrated their roles in wax biosynthesis and drought resistance . For oilseed crops, altering KCS8 expression could modify seed oil composition, potentially increasing the content of valuable VLCFAs for industrial applications or nutrition. This approach builds on findings from KCS18/FAE1, which determines the VLCFA content in seed oils . Additionally, engineering KCS8 expression might improve pathogen resistance by altering the composition of surface barrier lipids, as studies on KCS family members have linked cuticular wax composition to pathogen susceptibility. For cold tolerance improvement, modifying KCS8 activity could potentially alter membrane lipid composition, enhancing cold tolerance through changes in membrane fluidity. To implement these strategies, researchers can utilize various approaches including: (1) Conventional breeding focusing on natural KCS8 allelic variants associated with desired traits; (2) CRISPR/Cas9 gene editing to create specific modifications to KCS8; (3) Transgenic overexpression or tissue-specific expression of KCS8; (4) Promoter modifications to alter KCS8 expression patterns in response to environmental stimuli.

What are the current knowledge gaps in KCS8 research and future research priorities?

Despite advances in understanding the KCS family in Arabidopsis, significant knowledge gaps remain specifically for KCS8, creating important opportunities for future research. The precise tissue-specific expression pattern of KCS8 remains incompletely characterized, unlike other family members like KCS18, KCS6, or KCS9 that have well-documented expression profiles . Future studies should employ reporter gene constructs and tissue-specific transcriptomics to resolve this gap. The substrate specificity of KCS8 (preferred chain lengths and saturation levels of acyl-CoA substrates) requires detailed biochemical characterization through in vitro assays with purified recombinant protein . The specific VLCFA products dependent on KCS8 activity in vivo and their incorporation into different lipid classes remains to be elucidated through lipidomic analysis of kcs8 mutants. Regulatory mechanisms controlling KCS8 expression, including transcription factors, hormonal regulation, and epigenetic modifications, represent another critical knowledge gap. The potential functional redundancy between KCS8 and other KCS family members needs systematic investigation through analysis of higher-order mutants. The physiological consequences of KCS8 mutation or overexpression on plant development, stress responses, and reproduction remain largely unexplored, unlike other KCS genes with documented phenotypes . Addressing these knowledge gaps should be prioritized in future research to fully understand KCS8's role in plant lipid metabolism and physiology. Emerging technologies like CRISPR/Cas9 gene editing, single-cell transcriptomics, and advanced metabolic flux analysis will be valuable in answering these outstanding questions.

What are the key considerations for designing comprehensive KCS8 research programs?

Designing comprehensive research programs focused on KCS8 requires integration of multiple experimental approaches and consideration of several key factors. First, researchers should adopt a comparative approach that places KCS8 within the context of the entire KCS family, leveraging knowledge from better-characterized members like KCS18/FAE1, KCS6, and KCS9 . This contextualization will help generate testable hypotheses about KCS8 function. Second, research programs should implement multi-level analysis spanning from gene to whole-plant phenotype, including transcriptional regulation, protein function, metabolite profiles, and physiological outcomes. Third, genetic resources should be developed or obtained, including T-DNA insertion lines, CRISPR/Cas9-generated mutants, overexpression lines, and reporter constructs for spatial expression analysis. Fourth, researchers should establish collaborative networks that combine expertise in molecular biology, biochemistry, analytical chemistry, and plant physiology to address the multifaceted aspects of KCS8 function. Fifth, standardized protocols for enzyme assays, lipid extraction, and analytical methods should be implemented to ensure comparability of results across different studies. Finally, research programs should incorporate emerging technologies including CRISPR base editing for precise mutagenesis, advanced imaging techniques for subcellular localization, and systems biology approaches to place KCS8 function within metabolic networks. By addressing these considerations, researchers can develop comprehensive programs that will significantly advance our understanding of KCS8 function in plant lipid metabolism and its applications for crop improvement.

How should researchers approach the translation of KCS8 findings into applied agricultural contexts?

Translating KCS8 research findings into applied agricultural contexts requires a structured approach that bridges fundamental knowledge with practical applications. Initially, researchers should conduct comparative genomics analyses across crop species to identify KCS8 orthologs and paralogs, establishing their conservation and potential functional similarities to the Arabidopsis enzyme . Field trials are essential to evaluate the performance of KCS8-modified plants under realistic agricultural conditions, assessing traits like drought tolerance, pathogen resistance, and yield parameters over multiple seasons and locations. For genetic improvement strategies, researchers should consider both transgenic approaches (overexpression, RNAi, or CRISPR/Cas9 editing of KCS8) and marker-assisted selection targeting natural KCS8 variants associated with beneficial traits. Importantly, comprehensive phenotyping should be performed to identify any unintended consequences of KCS8 modification on plant development, reproduction, or stress responses . Economic analysis must evaluate the cost-benefit ratio of implementing KCS8-based traits in commercial varieties, considering factors like yield impact, stress tolerance benefits, and potential market value of modified oil profiles. Regulatory considerations should be addressed early in the translation process, particularly for transgenic approaches, by generating necessary safety data and engaging with regulatory agencies. Finally, stakeholder engagement with farmers, industry partners, and consumers is crucial for successful adoption of KCS8-based technologies. By systematically addressing these aspects, researchers can effectively translate KCS8 findings from model systems into valuable agricultural applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.