Recombinant Arabidopsis thaliana 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1 (3BETAHSD/D1)

Shipped with Ice Packs
In Stock

Description

General Information

Arabidopsis thaliana 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1 (3BETAHSD/D1) is an enzyme involved in sterol biosynthesis in the plant Arabidopsis thaliana . It is homologous to yeast protein Erg26p and mammalian protein sterol-4-α carboxylate 3-dehydrogenase, both of which also play a role in sterol biosynthesis .

Arabidopsis thaliana 3BETAHSD/D1 is also referred to as 4-α carboxysterol-C3-dehydrogenase . The protein sequence shows 46% amino acid identity with reticulon 20 (RTN20) and 82% identity with reticulon 19 (RTN19) .

Gene and Protein Features

The 3BETAHSD/D1 gene in Arabidopsis thaliana is located on chromosome 1 . The protein encoded by this gene is not predicted to have hydrophobic transmembrane domains or a signal peptide, but it does feature a potential endoplasmic reticulum (ER) retrieval signal at the C-terminus .

Key features of the Arabidopsis thaliana 3BETAHSD/D1 protein:

  • Molecular Weight: Information about the molecular weight of the recombinant protein can be found on product pages for the compound .

  • Domains: 3BETAHSD/D1 contains a predicted 3BETAHSD/D domain, suggesting a decarboxylating sterol-4-alpha-carboxylate 3-dehydrogenase activity .

  • Localization: Unexpectedly, 3BETAHSD/D1 is localized to ER exit sites (ERES) . This localization is consistent with enzymatic activity found in yeast microsomal fractions, but not cytosolic fractions, suggesting it may be membrane-bound .

Function and Activity

3BETAHSD/D1 functions in sterol biosynthesis and regulation . In vitro assays have demonstrated 3BETAHSD/D activity for both RTN19 and 3BETAHSD/D1 with a wide range of steroid substrates . Additionally, VIGS-mediated gene silencing of RTN19 and 3BETAHSD/D1 in tobacco resulted in the accumulation of 3-hydroxy-4,14-dimethyl-5-ergosta-9,19-cyclo-24(241)-en-4-carboxylic acid, which is consistent with a decrease in 3BETAHSD/D activity .

Mutant Studies and Phenotypes

Sterol levels were analyzed in root and leaf tissue of wild type Col0 Arabidopsis seedlings compared with lines heterozygous and homozygous for 3BETAHSD/D1 . The following table summarizes the key findings:

Wild Type (Col0)3betahsd/d1 Homozygous Mutant
Sterol Content in Roots223 ± 27 µg/g FWSignificant increase (p < 0.01)
Sterol Content in Leaves220 ± 21 µg/g FWNo significant change
PC and PE in Roots949 ± 36 µg/g FW (PC)No significant variation
894 ± 87 µg/g FW (PE)
PC and PE in Leaves912 ± 16 µg/g FW (PC)No significant variation
606 ± 16 µg/g FW (PE)
Sterols to Phospholipid Ratio RootsN/ASignificant increase (p < 0.01)

PC = phosphatidylcholine, PE = phosphatidylethanolamine, FW = fresh weight

While rtn20 and rtn19 mutants show a significant reduction in sterol content in Arabidopsis roots, 3betahsd/d1 mutants exhibit increased sterol levels . Detailed analysis of sterol composition did not reveal significant changes in specific sterol species, suggesting a role in the regulation of de novo bulk synthesis of sterols rather than specific sterol modifications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag, please inform us for preferential development.
Synonyms
3BETAHSD/D1; RTNLB24; At1g47290; T3F24.9; 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1; At3BETAHSD/D1; 4alpha-carboxysterol-C3-dehydrogenase/C4-decarboxylase isoform 1-1; Reticulon-like protein B24; AtRTNLB24; Sterol-4-alpha-carboxylate 3-dehydrogenase 1, decarboxylating
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-439
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
3BETAHSD/D1
Target Protein Sequence
MVMEVTETERWCVVTGGRGFAARHLVEMLVRYQMFHVRIADLAPAIVLNPHEETGILGEA IRSGRVQYVSADLRNKTQVVKGFQGAEVVFHMAAPDSSINNHQLQYSVNVQGTTNVIDAC IEVGVKRLIYTSSPSVVFDGVHGTLNADESLPYPPKHNDSYSATKAEGEALILKANGRSG LLTCCIRPSSIFGPGDKLMVPSLVTAARAGKSKFIIGDGSNFYDFTYVENVVHAHVCAER ALASGGEVCAKAAGQAYFITNMEPIKFWEFMSQLLEGLGYERPSIKIPASLMMPIAYLVE LAYKLLGPYGMKVPVLTPSRVRLLSCNRTFDSSKAKDRLGYSPVVPLQEGIKRTIDSFSH LKAQNQPKTEVTETIQWKKQTLIAIVILITLYHNFVATTGSSSVIITAVSKVLLVSSIFM FINGILPEKMKVFGSKKID
Uniprot No.

Target Background

Function

3β-hydroxysteroid dehydrogenase/decarboxylase (3βHSD/D) isoform 1 is involved in sterol biosynthesis. It catalyzes the conversion of 3β-hydroxysteroids-4α-carboxylate to 3-oxosteroids. This enzyme plays a regulatory role in inflorescence internode and leaf growth, potentially by influencing auxin transporter activity through alterations in membrane sterol composition.

Gene References Into Functions
  1. 3βHSD/D is a bifunctional short-chain dehydrogenase/reductase. Three-dimensional homology modeling identified key amino acids crucial for 4α-carboxy-sterol and NAD binding, and the catalytic activity of 3βHSD/D. [3βHSD/D] PMID: 19218365
Database Links

KEGG: ath:AT1G47290

STRING: 3702.AT1G47290.2

UniGene: At.38654

Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is 3BETAHSD/D1 in Arabidopsis thaliana and what are its alternative names?

3BETAHSD/D1 (At1g47290) is a bifunctional enzyme that functions as a 3β-hydroxysteroid dehydrogenase/C4-decarboxylase in Arabidopsis thaliana. It is also known as:

  • 4alpha-carboxysterol-C3-dehydrogenase/C4-decarboxylase isoform 1-1

  • Reticulon-like protein B (RTNLB24)

  • At3BETAHSD/D1

The enzyme has the EC number 1.1.1.170 and is part of the sterol biosynthesis pathway, specifically involved in the C4-demethylation process. It is one of two characterized 3BETAHSD/D enzymes in Arabidopsis, the other being 3BETAHSD/D2 (At2g26260) .

What is the function of 3BETAHSD/D1 in sterol biosynthesis?

3BETAHSD/D1 plays a critical role in the sterol biosynthesis pathway, specifically in C4-demethylation reactions. This enzyme:

  • Catalyzes the removal of an oxidized methyl (carboxylic) group at C4 position

  • Simultaneously catalyzes the 3β-hydroxyl→3-keto oxidation

  • Is part of the sterol C4-demethylation complex (SC4DM)

  • Specifically accepts sterol substrates with 3β-hydroxyl and C4 carboxyl groups

  • Works alongside other enzymes like sterol-4α-methyl oxidases (SMO) to complete C4-demethylation reactions

The C4-demethylation process is essential for the biosynthesis of C27–29 sterols from their C30 precursor squalene, which involves the removal of three methyl groups, including two at the C4 position .

How does 3BETAHSD/D1 differ from its homolog 3BETAHSD/D2?

Both 3BETAHSD/D1 (At1g47290) and 3BETAHSD/D2 (At2g26260) share high sequence similarity and functional redundancy in Arabidopsis, but they differ in several aspects:

Characteristic3BETAHSD/D13BETAHSD/D2
Gene locusAt1g47290At2g26260
Cellular localizationMay localize to ER exit sites Primarily in endoplasmic reticulum
Expression patternsTissue-specific differences may existTissue-specific differences may exist
Functional redundancySingle knockout shows no phenotypeSingle knockout shows no phenotype
Catalytic activitySimilar substrate specificitySimilar substrate specificity

Despite their differences, both enzymes exhibit functional redundancy, as single knockout mutants of either gene produce no visible phenotypes, while double knockout mutants show male gametophytic lethality .

What are the most effective methods for generating and confirming knockout mutants of 3BETAHSD/D1?

Based on recent research, CRISPR/Cas9-based genome editing has proven more effective than T-DNA insertion for generating true knockout mutants of 3BETAHSD/D1. A methodological approach would include:

  • CRISPR/Cas9 design:

    • Design gRNAs targeting exonic regions of the 3BETAHSD/D1 gene

    • Create a CRISPR/Cas9 construct with plant-specific promoters

    • Transform into Arabidopsis using Agrobacterium-mediated transformation

  • Mutant screening:

    • Screen T1 plants for the presence of the antibiotic resistance marker

    • Examine self-pollinated T2 offspring for transgene-free plants with mutations

    • Verify mutations through PCR amplification and sequencing

  • Confirmation steps:

    • Sequence analysis to identify frame-shifting mutations (e.g., insertions/deletions)

    • RT-PCR and qRT-PCR to verify absence of functional transcript

    • Western blot to confirm protein absence (if antibodies available)

    • Phenotypic analysis to identify any visible defects

This approach was successfully used to create true knockout mutations in 3BETAHSD/D1, revealing a single adenine nucleotide insertion at position 423 bp downstream of the initiation codon in the third exon, causing a frameshift and premature translational termination .

How can one effectively design experiments to study the functional redundancy between 3BETAHSD/D1 and 3BETAHSD/D2?

To effectively study the functional redundancy between 3BETAHSD/D1 and 3BETAHSD/D2, a comprehensive experimental approach could include:

  • Generation of single and double mutants:

    • Create single knockout mutants of both genes (hsd1 and hsd2)

    • Generate heterozygous double mutants (hsd1 hsd2/+ and hsd1/+ hsd2)

    • Attempt to obtain homozygous double mutants (hsd1 hsd2)

  • Complementation studies:

    • Create tissue-specific complementation constructs (e.g., pLAT52::HSD2-FLAG)

    • Transform these constructs into the heterozygous double mutants

    • Analyze if tissue-specific expression can rescue the phenotype

  • Phenotypic analysis across developmental stages:

    • Examine vegetative growth in single and double mutants

    • Assess reproductive development, particularly pollen development

    • Analyze embryo development in rescued lines

  • Biochemical analysis:

    • Measure sterol content and composition in different mutant backgrounds

    • Analyze metabolic intermediates in the sterol biosynthesis pathway

    • Perform enzyme activity assays with recombinant proteins

This approach has revealed that while single mutants (hsd1 or hsd2) show no visible phenotype, double homozygous mutants (hsd1 hsd2) could not be obtained due to male gametophytic lethality. Further, pollen-specific expression of HSD2 in the hsd1 hsd2/+ background rescued pollen lethality but revealed embryonic defects, demonstrating the essential roles of these genes in both male gametogenesis and embryogenesis .

What are the recommended protocols for expressing and purifying recombinant 3BETAHSD/D1 protein?

For successful expression and purification of recombinant 3BETAHSD/D1 protein, the following methodological approach is recommended:

  • Cloning strategy:

    • Amplify the full-length coding sequence (CDS) of 3BETAHSD/D1 (439 amino acids)

    • Include appropriate restriction sites for directional cloning

    • Optional: Add tag sequences (His, FLAG, etc.) for purification and detection

    • Clone into an expression vector with an inducible promoter

  • Expression systems options:

    • Bacterial expression (E. coli):

      • BL21(DE3) or Rosetta strains for better codon usage

      • Optimize induction conditions (temperature, IPTG concentration, time)

      • Consider using chaperone co-expression for proper folding

    • Yeast expression (S. cerevisiae or P. pastoris):

      • Particularly useful as the enzyme functionally complements yeast erg25 mutants

      • Allows proper post-translational modifications

      • Can be secreted for easier purification

    • Insect cell expression (Sf9 or Hi5):

      • Baculovirus expression system for higher yields

      • Better folding and post-translational modifications

      • More expensive but potentially higher activity

  • Purification strategy:

    • Affinity chromatography (Ni-NTA for His-tag or anti-FLAG for FLAG-tag)

    • Ion exchange chromatography as a secondary purification step

    • Size exclusion chromatography for final polishing

    • Maintain reducing conditions throughout purification

    • Include protease inhibitors to prevent degradation

  • Activity verification:

    • Enzymatic assay using NAD+ as cofactor and appropriate sterol substrates

    • Monitor conversion by HPLC, GC-MS, or spectrophotometric methods

    • Verify protein integrity by SDS-PAGE and Western blotting

This protocol is based on successful approaches for expressing similar enzymes, considering that 3BETAHSD/D1 is a membrane-associated enzyme involved in sterol metabolism .

How do mutations in 3BETAHSD/D1 and 3BETAHSD/D2 affect male gametophyte development at the molecular and cellular levels?

Mutations affecting both 3BETAHSD/D1 and 3BETAHSD/D2 cause male gametophytic lethality in Arabidopsis. At the molecular and cellular levels, this can be explained by:

  • Sterol composition disruption:

    • Double mutant pollen likely accumulates aberrant sterols with C4-methyl groups

    • These abnormal sterols disrupt membrane integrity and fluidity

    • Proper sterol composition is critical for plasma membrane and endomembrane system function during pollen development

  • Cellular mechanisms affected:

    • Pollen tube growth: Requires precise membrane dynamics and targeted secretion

    • Cytoskeletal organization: Depends on proper membrane-cytoskeleton interactions

    • Vesicular trafficking: Essential for pollen tube elongation and sperm cell delivery

    • Signaling pathways: Membrane sterol rafts are important for signal transduction

  • Developmental consequences:

    • Potential arrest during pollen germination

    • Defects in pollen tube guidance

    • Compromised sperm cell formation or function

    • Failed fertilization

Research employing genetic complementation with pollen-specific promoters (pLAT52::HSD2-FLAG) successfully rescued the pollen lethality phenotype, confirming that the defect is cell-autonomous and specific to the function of these enzymes in pollen development .

What is the relationship between 3BETAHSD/D1 and membrane organization in Arabidopsis cells?

3BETAHSD/D1 plays critical roles in membrane organization in Arabidopsis cells through its function in sterol biosynthesis:

  • Subcellular localization and membrane domains:

    • 3BETAHSD/D1 may be uniquely localized to ER exit sites, unlike its homolog

    • This distinct localization suggests specific roles in membrane trafficking

    • May influence the formation of specialized membrane domains or lipid rafts

  • Impact on membrane properties:

    • Proper sterol composition is essential for:

      • Membrane fluidity and permeability

      • Formation of membrane microdomains

      • Protein sorting and trafficking

      • Cell polarity establishment and maintenance

  • Effects on membrane-associated processes:

    • Auxin transport: Overexpression lines show altered responses to auxin transport inhibitors like NPA

    • Vesicular trafficking: Likely influences protein and lipid trafficking between organelles

    • Cell expansion: Affects cell wall-plasma membrane interactions during growth

  • Observed phenotypes related to membrane function:

    • Overexpression of 3BETAHSD/D genes results in:

      • Wrinkled leaves due to uneven cell expansion

      • Short inflorescence internodes

      • Altered gravitropic responses

These findings suggest that 3BETAHSD/D1 influences not just sterol biosynthesis but also broader aspects of membrane organization that affect multiple cellular processes including hormone transport and cell expansion .

How does the 3BETAHSD/D1 enzyme differ structurally and functionally from its counterparts in other organisms?

3BETAHSD/D1 shares functional similarities with 3β-hydroxysteroid dehydrogenases across different kingdoms but exhibits important structural and functional differences:

  • Structural comparisons:

OrganismEnzymeKey Structural FeaturesCofactor Preference
Arabidopsis3BETAHSD/D1Has plant-specific domains, membrane-associatedNAD+
YeastERG26Shares conserved catalytic residues with plant enzymesNAD+
HumansHSD3B1/HSD3B2Additional isomerase domain for progesterone synthesisNAD+
BacteriaSimilar dehydrogenasesSimpler structure, solubleVarious
  • Functional differences:

    • Substrate specificity:

      • Plant 3BETAHSD/D1: Acts on plant sterols during C4-demethylation

      • Human HSD3B1/2: Converts pregnenolone to progesterone, DHEA to androstenedione

      • Yeast ERG26: Involved in ergosterol biosynthesis

    • Physiological roles:

      • Plants: Essential for gametogenesis and embryo development

      • Mammals: Critical for steroid hormone production (deficiency causes congenital adrenal hyperplasia)

      • Yeast: Required for ergosterol synthesis (essential for growth)

  • Evolutionary insights:

    • Conserved catalytic residues across kingdoms suggest ancient evolutionary origin

    • Functional specialization occurred during evolution of different sterol biosynthesis pathways

    • Plant enzymes evolved specific features for phytosterol biosynthesis

Studies comparing plant 3BETAHSD/D1 with human 3β-HSD enzymes revealed conservation of key catalytic residues (like Tyr-154, His/Tyr-156, and Lys-158 in human enzymes) despite their divergent physiological roles .

How should researchers interpret phenotypic data from 3BETAHSD/D1 overexpression versus knockout studies?

Interpreting phenotypic data from 3BETAHSD/D1 manipulation studies requires careful consideration of several factors:

  • Contrasting phenotypes:

Genetic ManipulationObserved PhenotypesInterpretation
Single knockout (hsd1)No visible phenotypeFunctional redundancy with HSD2
Double knockout (hsd1 hsd2)Male gametophytic lethalityEssential function in reproduction
OverexpressionWrinkled leaves, short internodesDisruption of sterol homeostasis
Tissue-specific complementationRescue of specific defectsTissue-specific requirements
  • Key considerations for data interpretation:

    • Dosage effects: Sterol metabolism requires precise enzyme levels; both too little and too much can disrupt homeostasis

    • Opportunistic effects: Overexpression phenotypes may be variable even within the same plant (e.g., some stems more affected than others)

    • Developmental context: Effects may be stage-specific or tissue-specific

    • Pathway compensation: Other enzymes in the sterol pathway may compensate differently in knockouts versus overexpression

    • Indirect effects: Changes in membrane properties may affect multiple cellular processes

  • Molecular basis for phenotypic outcomes:

    • Knockout effects: Absence of both enzymes prevents essential sterol modifications

    • Overexpression effects: May cause:

      • Altered sterol composition rather than total sterol content

      • Membrane organization disruption

      • Altered hormone transport (particularly auxin)

      • Changed cell wall-plasma membrane interactions

When interpreting these findings, researchers should note that overexpression phenotypes are not simply the opposite of loss-of-function effects but reflect complex disruptions to sterol homeostasis that affect specific developmental processes .

What approaches should be used to analyze changes in sterol profiles resulting from manipulation of 3BETAHSD/D1 expression?

Comprehensive analysis of sterol profiles following 3BETAHSD/D1 manipulation requires multiple analytical approaches:

  • Sample preparation protocols:

    • Tissue extraction:

      • Fresh tissue harvesting with immediate freezing in liquid nitrogen

      • Homogenization in organic solvents (chloroform:methanol mixtures)

      • Saponification to hydrolyze sterol esters (if total sterols are desired)

      • Solid-phase extraction for cleanup

    • Fractionation:

      • Separate free sterols, sterol glycosides, and sterol esters

      • Use different solvent systems for various sterol classes

      • Consider subcellular fractionation to analyze membrane-specific changes

  • Analytical methods:

    MethodApplicationAdvantagesLimitations
    GC-MSSterol identification and quantificationHigh resolution, sensitive, good for comparing profilesRequires derivatization
    LC-MS/MSComplex sterol mixtures, polar conjugatesNo derivatization needed, good for intact conjugatesLower resolution for isomers
    TLCRapid screeningSimple, cost-effective, visualLimited resolution, semi-quantitative
    NMRStructural confirmationDetailed structural informationRequires larger sample amounts
  • Data processing and interpretation:

    • Targeted analysis:

      • Focus on specific sterols and intermediates in the C4-demethylation pathway

      • Compare ratios of substrate:product pairs to assess enzyme activity

      • Monitor accumulation of 4α-methyl sterols as indicators of 3BETAHSD/D activity

    • Untargeted analysis:

      • Use multivariate statistical methods (PCA, PLS-DA) to identify patterns

      • Search for unexpected sterol species or pathway intermediates

      • Compare profiles across different tissues and developmental stages

  • Functional correlation:

    • Link specific sterol changes to observed phenotypes

    • Correlate membrane properties with sterol composition

    • Examine impacts on specific cellular processes (e.g., auxin transport)

This comprehensive approach allows researchers to not only identify changes in sterol profiles but also understand how these changes affect plant development and physiology .

How can researchers distinguish between direct and indirect effects of 3BETAHSD/D1 manipulation on plant development?

Distinguishing between direct and indirect effects of 3BETAHSD/D1 manipulation requires a multifaceted experimental approach:

  • Temporal analysis:

    • Use inducible expression/knockdown systems to determine immediate versus delayed effects

    • Track developmental processes chronologically after gene manipulation

    • Identify primary biochemical changes that precede phenotypic alterations

  • Molecular approaches:

    • Transcriptome analysis:

      • Compare gene expression changes at multiple time points after manipulation

      • Identify immediate transcriptional responses versus secondary adaptations

      • Use pathway enrichment to identify affected cellular processes

    • Metabolome analysis:

      • Focus on sterol intermediate accumulation as direct effects

      • Monitor changes in hormone levels as potential secondary effects

      • Examine broader metabolic alterations as adaptive responses

  • Complementation experiments:

    • Chemical complementation:

      • Test if providing specific sterols can rescue phenotypes

      • Apply hormone treatments to determine if developmental defects are hormone-related

      • Use inhibitors of specific pathways to isolate effects

    • Genetic complementation:

      • Use tissue-specific promoters to express the gene in specific cell types

      • Create chimeric enzymes with altered activity or localization

      • Perform rescue experiments with related enzymes from other species

  • Cellular and subcellular analyses:

    • Track changes in membrane properties (fluidity, organization)

    • Monitor protein trafficking and localization

    • Examine cytoskeletal organization and dynamics

  • Statistical modeling:

    • Use conditional independence testing to distinguish direct from indirect effects

    • Apply path analysis to model causal relationships between observed changes

    • Develop predictive models based on time-course data

By combining these approaches, researchers can build a causal network model that distinguishes primary effects of altered sterol biosynthesis from secondary developmental consequences .

What are common challenges in studying 3BETAHSD/D1 function and how can they be addressed?

Researchers face several challenges when studying 3BETAHSD/D1 function, with corresponding solutions:

  • Functional redundancy with 3BETAHSD/D2:

    • Challenge: Single mutants show no phenotype due to compensation

    • Solutions:

      • Generate double mutants with tissue-specific rescue constructs

      • Use inducible knockdown of both genes simultaneously

      • Employ CRISPR/Cas9 for precise genome editing of both genes

      • Consider analyzing subtle changes in single mutants under stress conditions

  • Membrane-associated protein expression and purification:

    • Challenge: Difficult to express and purify in active form

    • Solutions:

      • Optimize detergent selection for solubilization

      • Use mild non-ionic detergents (DDM, CHAPS)

      • Consider nanodiscs or styrene maleic acid lipid particles (SMALPs)

      • Express with fusion partners that enhance solubility

  • Complex sterol analysis:

    • Challenge: Difficult to separate and quantify similar sterol intermediates

    • Solutions:

      • Develop targeted MS/MS methods for specific sterols

      • Use multiple chromatographic approaches (reverse phase, normal phase)

      • Consider derivatization strategies to enhance separation

      • Implement internal standards for accurate quantification

  • Phenotypic subtlety or variability:

    • Challenge: Phenotypes may be opportunistic or environment-dependent

    • Solutions:

      • Standardize growth conditions rigorously

      • Increase biological replication

      • Implement quantitative phenotyping approaches

      • Examine plants under multiple environmental conditions

  • Distinguishing primary from secondary effects:

    • Challenge: Determining causal relationships in complex developmental processes

    • Solutions:

      • Use time-course experiments with high temporal resolution

      • Implement inducible systems for controlled gene manipulation

      • Combine with pharmacological approaches to test specific hypotheses

      • Use microscopy to track cellular events in real-time

Addressing these challenges requires integrated approaches that combine genetic, biochemical, and analytical techniques tailored to the specific aspects of 3BETAHSD/D1 function being investigated .

How can enzyme activity assays for recombinant 3BETAHSD/D1 be optimized for reliability and reproducibility?

Optimizing enzyme activity assays for recombinant 3BETAHSD/D1 requires attention to multiple factors:

  • Substrate preparation and handling:

    • Challenges: Sterol substrates are hydrophobic and prone to oxidation

    • Solutions:

      • Prepare fresh stock solutions in appropriate solvents (ethanol, DMSO)

      • Keep concentration of organic solvents <5% in assay

      • Store under nitrogen and protect from light

      • Include antioxidants where appropriate

      • Verify substrate purity by analytical methods before use

  • Optimized reaction conditions:

    ParameterOptimization ApproachTypical Range to Test
    pHTest range around physiological pHpH 6.5-8.5
    TemperatureBalance activity with stability25-37°C
    Ionic strengthVary salt concentration50-300 mM NaCl
    Cofactor (NAD+)Titrate to determine optimal concentration0.1-2 mM
    DetergentTest various types and concentrations0.01-0.1%
    TimeEnsure linearity of reaction5-60 minutes
  • Detection methods:

    • Spectrophotometric: Monitor NAD+ reduction at 340 nm

      • Pro: Real-time monitoring

      • Con: Less sensitive, interference possible

    • Chromatographic: HPLC or GC-MS analysis of substrate conversion

      • Pro: Direct product detection, higher specificity

      • Con: Labor-intensive, endpoint only

    • Radiometric: Using labeled substrates

      • Pro: High sensitivity

      • Con: Safety concerns, specialized equipment

  • Controls and validation:

    • Include heat-inactivated enzyme controls

    • Perform substrate and enzyme titrations

    • Validate with known inhibitors if available

    • Confirm product identity by MS

    • Determine kinetic parameters (Km, Vmax) under optimized conditions

  • Specific considerations for 3BETAHSD/D1:

    • Membrane association may require detergent or lipid reconstitution

    • Consider coupling to other enzymes in the C4-demethylation pathway

    • Monitor both dehydrogenase and decarboxylase activities

    • Test with physiologically relevant plant sterol substrates

By systematically optimizing these parameters and implementing appropriate controls, researchers can develop reliable and reproducible assays for 3BETAHSD/D1 enzyme activity .

What strategies can improve the expression of functional 3BETAHSD/D1 for structural studies?

Obtaining sufficient amounts of functional 3BETAHSD/D1 for structural studies presents several challenges. Here are strategic approaches to overcome them:

  • Expression system optimization:

    Expression SystemAdvantagesConsiderationsOptimization Strategies
    E. coliRapid, inexpensiveMay form inclusion bodiesUse specialized strains (C41/C43, Rosetta); lower temperature (16-20°C); solubility tags
    YeastEukaryotic processingLower yieldsOptimize codon usage; use strong inducible promoters; select appropriate strain
    Insect cellsHigh-quality proteinComplex, expensiveOptimize MOI; harvest timing; supplementation with sterols
    Plant expressionNative environmentLower yieldsUse strong viral promoters; transient expression systems
  • Construct design strategies:

    • Remove putative membrane-spanning regions if not essential for activity

    • Create fusion proteins with highly soluble partners (MBP, SUMO, Trx)

    • Include purification tags that can enhance solubility (His, GST)

    • Design truncated constructs focused on catalytic domains

    • Consider chimeric constructs with stable homologs from other species

  • Protein stabilization approaches:

    • Screen detergents systematically (from harsh to mild)

    • Test lipid nanodisc incorporation for membrane proteins

    • Add ligands or substrates during purification to stabilize active conformation

    • Include glycerol (5-10%) in buffers to enhance stability

    • Optimize buffer composition (pH, salt, additives)

    • Consider adding specific lipids that might be required for folding/function

  • Advanced techniques for structural studies:

    • Use FSEC (fluorescence-detection size exclusion chromatography) to rapidly screen constructs

    • Apply surface entropy reduction to enhance crystallizability

    • Consider antibody fragment co-crystallization to provide crystal contacts

    • Explore cryo-EM as an alternative to crystallography

    • Implement hydrogen-deuterium exchange mass spectrometry for dynamic studies

    • Use computational modeling based on homologous structures

  • Quality control metrics:

    • Develop activity assays to verify functional expression

    • Use SEC-MALS to assess homogeneity and oligomeric state

    • Implement thermal shift assays to evaluate stability

    • Verify proper folding using circular dichroism

    • Apply native MS to assess cofactor binding

By systematically applying these strategies and focusing on protein quality rather than just quantity, researchers can improve chances of obtaining functional 3BETAHSD/D1 suitable for structural studies .

Frequently Asked Questions for Researchers Studying Recombinant Arabidopsis thaliana 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1 (3BETAHSD/D1)

What is 3BETAHSD/D1 in Arabidopsis thaliana and what are its alternative names?

3BETAHSD/D1 (At1g47290) is a bifunctional enzyme that functions as a 3β-hydroxysteroid dehydrogenase/C4-decarboxylase in Arabidopsis thaliana. It is also known as:

  • 4alpha-carboxysterol-C3-dehydrogenase/C4-decarboxylase isoform 1-1

  • Reticulon-like protein B (RTNLB24)

  • At3BETAHSD/D1

The enzyme has the EC number 1.1.1.170 and is part of the sterol biosynthesis pathway, specifically involved in the C4-demethylation process. It is one of two characterized 3BETAHSD/D enzymes in Arabidopsis, the other being 3BETAHSD/D2 (At2g26260) .

What is the function of 3BETAHSD/D1 in sterol biosynthesis?

3BETAHSD/D1 plays a critical role in the sterol biosynthesis pathway, specifically in C4-demethylation reactions. This enzyme:

  • Catalyzes the removal of an oxidized methyl (carboxylic) group at C4 position

  • Simultaneously catalyzes the 3β-hydroxyl→3-keto oxidation

  • Is part of the sterol C4-demethylation complex (SC4DM)

  • Specifically accepts sterol substrates with 3β-hydroxyl and C4 carboxyl groups

  • Works alongside other enzymes like sterol-4α-methyl oxidases (SMO) to complete C4-demethylation reactions

The C4-demethylation process is essential for the biosynthesis of C27–29 sterols from their C30 precursor squalene, which involves the removal of three methyl groups, including two at the C4 position .

How does 3BETAHSD/D1 differ from its homolog 3BETAHSD/D2?

Both 3BETAHSD/D1 (At1g47290) and 3BETAHSD/D2 (At2g26260) share high sequence similarity and functional redundancy in Arabidopsis, but they differ in several aspects:

Characteristic3BETAHSD/D13BETAHSD/D2
Gene locusAt1g47290At2g26260
Cellular localizationMay localize to ER exit sites Primarily in endoplasmic reticulum
Expression patternsTissue-specific differences may existTissue-specific differences may exist
Functional redundancySingle knockout shows no phenotypeSingle knockout shows no phenotype
Catalytic activitySimilar substrate specificitySimilar substrate specificity

Despite their differences, both enzymes exhibit functional redundancy, as single knockout mutants of either gene produce no visible phenotypes, while double knockout mutants show male gametophytic lethality .

What are the most effective methods for generating and confirming knockout mutants of 3BETAHSD/D1?

Based on recent research, CRISPR/Cas9-based genome editing has proven more effective than T-DNA insertion for generating true knockout mutants of 3BETAHSD/D1. A methodological approach would include:

  • CRISPR/Cas9 design:

    • Design gRNAs targeting exonic regions of the 3BETAHSD/D1 gene

    • Create a CRISPR/Cas9 construct with plant-specific promoters

    • Transform into Arabidopsis using Agrobacterium-mediated transformation

  • Mutant screening:

    • Screen T1 plants for the presence of the antibiotic resistance marker

    • Examine self-pollinated T2 offspring for transgene-free plants with mutations

    • Verify mutations through PCR amplification and sequencing

  • Confirmation steps:

    • Sequence analysis to identify frame-shifting mutations (e.g., insertions/deletions)

    • RT-PCR and qRT-PCR to verify absence of functional transcript

    • Western blot to confirm protein absence (if antibodies available)

    • Phenotypic analysis to identify any visible defects

This approach was successfully used to create true knockout mutations in 3BETAHSD/D1, revealing a single adenine nucleotide insertion at position 423 bp downstream of the initiation codon in the third exon, causing a frameshift and premature translational termination .

How can one effectively design experiments to study the functional redundancy between 3BETAHSD/D1 and 3BETAHSD/D2?

To effectively study the functional redundancy between 3BETAHSD/D1 and 3BETAHSD/D2, a comprehensive experimental approach could include:

  • Generation of single and double mutants:

    • Create single knockout mutants of both genes (hsd1 and hsd2)

    • Generate heterozygous double mutants (hsd1 hsd2/+ and hsd1/+ hsd2)

    • Attempt to obtain homozygous double mutants (hsd1 hsd2)

  • Complementation studies:

    • Create tissue-specific complementation constructs (e.g., pLAT52::HSD2-FLAG)

    • Transform these constructs into the heterozygous double mutants

    • Analyze if tissue-specific expression can rescue the phenotype

  • Phenotypic analysis across developmental stages:

    • Examine vegetative growth in single and double mutants

    • Assess reproductive development, particularly pollen development

    • Analyze embryo development in rescued lines

  • Biochemical analysis:

    • Measure sterol content and composition in different mutant backgrounds

    • Analyze metabolic intermediates in the sterol biosynthesis pathway

    • Perform enzyme activity assays with recombinant proteins

This approach has revealed that while single mutants (hsd1 or hsd2) show no visible phenotype, double homozygous mutants (hsd1 hsd2) could not be obtained due to male gametophytic lethality. Further, pollen-specific expression of HSD2 in the hsd1 hsd2/+ background rescued pollen lethality but revealed embryonic defects, demonstrating the essential roles of these genes in both male gametogenesis and embryogenesis .

What are the recommended protocols for expressing and purifying recombinant 3BETAHSD/D1 protein?

For successful expression and purification of recombinant 3BETAHSD/D1 protein, the following methodological approach is recommended:

  • Cloning strategy:

    • Amplify the full-length coding sequence (CDS) of 3BETAHSD/D1 (439 amino acids)

    • Include appropriate restriction sites for directional cloning

    • Optional: Add tag sequences (His, FLAG, etc.) for purification and detection

    • Clone into an expression vector with an inducible promoter

  • Expression systems options:

    • Bacterial expression (E. coli):

      • BL21(DE3) or Rosetta strains for better codon usage

      • Optimize induction conditions (temperature, IPTG concentration, time)

      • Consider using chaperone co-expression for proper folding

    • Yeast expression (S. cerevisiae or P. pastoris):

      • Particularly useful as the enzyme functionally complements yeast erg25 mutants

      • Allows proper post-translational modifications

      • Can be secreted for easier purification

    • Insect cell expression (Sf9 or Hi5):

      • Baculovirus expression system for higher yields

      • Better folding and post-translational modifications

      • More expensive but potentially higher activity

  • Purification strategy:

    • Affinity chromatography (Ni-NTA for His-tag or anti-FLAG for FLAG-tag)

    • Ion exchange chromatography as a secondary purification step

    • Size exclusion chromatography for final polishing

    • Maintain reducing conditions throughout purification

    • Include protease inhibitors to prevent degradation

  • Activity verification:

    • Enzymatic assay using NAD+ as cofactor and appropriate sterol substrates

    • Monitor conversion by HPLC, GC-MS, or spectrophotometric methods

    • Verify protein integrity by SDS-PAGE and Western blotting

This protocol is based on successful approaches for expressing similar enzymes, considering that 3BETAHSD/D1 is a membrane-associated enzyme involved in sterol metabolism .

How do mutations in 3BETAHSD/D1 and 3BETAHSD/D2 affect male gametophyte development at the molecular and cellular levels?

Mutations affecting both 3BETAHSD/D1 and 3BETAHSD/D2 cause male gametophytic lethality in Arabidopsis. At the molecular and cellular levels, this can be explained by:

  • Sterol composition disruption:

    • Double mutant pollen likely accumulates aberrant sterols with C4-methyl groups

    • These abnormal sterols disrupt membrane integrity and fluidity

    • Proper sterol composition is critical for plasma membrane and endomembrane system function during pollen development

  • Cellular mechanisms affected:

    • Pollen tube growth: Requires precise membrane dynamics and targeted secretion

    • Cytoskeletal organization: Depends on proper membrane-cytoskeleton interactions

    • Vesicular trafficking: Essential for pollen tube elongation and sperm cell delivery

    • Signaling pathways: Membrane sterol rafts are important for signal transduction

  • Developmental consequences:

    • Potential arrest during pollen germination

    • Defects in pollen tube guidance

    • Compromised sperm cell formation or function

    • Failed fertilization

Research employing genetic complementation with pollen-specific promoters (pLAT52::HSD2-FLAG) successfully rescued the pollen lethality phenotype, confirming that the defect is cell-autonomous and specific to the function of these enzymes in pollen development .

What is the relationship between 3BETAHSD/D1 and membrane organization in Arabidopsis cells?

3BETAHSD/D1 plays critical roles in membrane organization in Arabidopsis cells through its function in sterol biosynthesis:

  • Subcellular localization and membrane domains:

    • 3BETAHSD/D1 may be uniquely localized to ER exit sites, unlike its homolog

    • This distinct localization suggests specific roles in membrane trafficking

    • May influence the formation of specialized membrane domains or lipid rafts

  • Impact on membrane properties:

    • Proper sterol composition is essential for:

      • Membrane fluidity and permeability

      • Formation of membrane microdomains

      • Protein sorting and trafficking

      • Cell polarity establishment and maintenance

  • Effects on membrane-associated processes:

    • Auxin transport: Overexpression lines show altered responses to auxin transport inhibitors like NPA

    • Vesicular trafficking: Likely influences protein and lipid trafficking between organelles

    • Cell expansion: Affects cell wall-plasma membrane interactions during growth

  • Observed phenotypes related to membrane function:

    • Overexpression of 3BETAHSD/D genes results in:

      • Wrinkled leaves due to uneven cell expansion

      • Short inflorescence internodes

      • Altered gravitropic responses

These findings suggest that 3BETAHSD/D1 influences not just sterol biosynthesis but also broader aspects of membrane organization that affect multiple cellular processes including hormone transport and cell expansion .

How does the 3BETAHSD/D1 enzyme differ structurally and functionally from its counterparts in other organisms?

3BETAHSD/D1 shares functional similarities with 3β-hydroxysteroid dehydrogenases across different kingdoms but exhibits important structural and functional differences:

  • Structural comparisons:

OrganismEnzymeKey Structural FeaturesCofactor Preference
Arabidopsis3BETAHSD/D1Has plant-specific domains, membrane-associatedNAD+
YeastERG26Shares conserved catalytic residues with plant enzymesNAD+
HumansHSD3B1/HSD3B2Additional isomerase domain for progesterone synthesisNAD+
BacteriaSimilar dehydrogenasesSimpler structure, solubleVarious
  • Functional differences:

    • Substrate specificity:

      • Plant 3BETAHSD/D1: Acts on plant sterols during C4-demethylation

      • Human HSD3B1/2: Converts pregnenolone to progesterone, DHEA to androstenedione

      • Yeast ERG26: Involved in ergosterol biosynthesis

    • Physiological roles:

      • Plants: Essential for gametogenesis and embryo development

      • Mammals: Critical for steroid hormone production (deficiency causes congenital adrenal hyperplasia)

      • Yeast: Required for ergosterol synthesis (essential for growth)

  • Evolutionary insights:

    • Conserved catalytic residues across kingdoms suggest ancient evolutionary origin

    • Functional specialization occurred during evolution of different sterol biosynthesis pathways

    • Plant enzymes evolved specific features for phytosterol biosynthesis

Studies comparing plant 3BETAHSD/D1 with human 3β-HSD enzymes revealed conservation of key catalytic residues (like Tyr-154, His/Tyr-156, and Lys-158 in human enzymes) despite their divergent physiological roles .

How should researchers interpret phenotypic data from 3BETAHSD/D1 overexpression versus knockout studies?

Interpreting phenotypic data from 3BETAHSD/D1 manipulation studies requires careful consideration of several factors:

  • Contrasting phenotypes:

Genetic ManipulationObserved PhenotypesInterpretation
Single knockout (hsd1)No visible phenotypeFunctional redundancy with HSD2
Double knockout (hsd1 hsd2)Male gametophytic lethalityEssential function in reproduction
OverexpressionWrinkled leaves, short internodesDisruption of sterol homeostasis
Tissue-specific complementationRescue of specific defectsTissue-specific requirements
  • Key considerations for data interpretation:

    • Dosage effects: Sterol metabolism requires precise enzyme levels; both too little and too much can disrupt homeostasis

    • Opportunistic effects: Overexpression phenotypes may be variable even within the same plant (e.g., some stems more affected than others)

    • Developmental context: Effects may be stage-specific or tissue-specific

    • Pathway compensation: Other enzymes in the sterol pathway may compensate differently in knockouts versus overexpression

    • Indirect effects: Changes in membrane properties may affect multiple cellular processes

  • Molecular basis for phenotypic outcomes:

    • Knockout effects: Absence of both enzymes prevents essential sterol modifications

    • Overexpression effects: May cause:

      • Altered sterol composition rather than total sterol content

      • Membrane organization disruption

      • Altered hormone transport (particularly auxin)

      • Changed cell wall-plasma membrane interactions

When interpreting these findings, researchers should note that overexpression phenotypes are not simply the opposite of loss-of-function effects but reflect complex disruptions to sterol homeostasis that affect specific developmental processes .

What approaches should be used to analyze changes in sterol profiles resulting from manipulation of 3BETAHSD/D1 expression?

Comprehensive analysis of sterol profiles following 3BETAHSD/D1 manipulation requires multiple analytical approaches:

  • Sample preparation protocols:

    • Tissue extraction:

      • Fresh tissue harvesting with immediate freezing in liquid nitrogen

      • Homogenization in organic solvents (chloroform:methanol mixtures)

      • Saponification to hydrolyze sterol esters (if total sterols are desired)

      • Solid-phase extraction for cleanup

    • Fractionation:

      • Separate free sterols, sterol glycosides, and sterol esters

      • Use different solvent systems for various sterol classes

      • Consider subcellular fractionation to analyze membrane-specific changes

  • Analytical methods:

    MethodApplicationAdvantagesLimitations
    GC-MSSterol identification and quantificationHigh resolution, sensitive, good for comparing profilesRequires derivatization
    LC-MS/MSComplex sterol mixtures, polar conjugatesNo derivatization needed, good for intact conjugatesLower resolution for isomers
    TLCRapid screeningSimple, cost-effective, visualLimited resolution, semi-quantitative
    NMRStructural confirmationDetailed structural informationRequires larger sample amounts
  • Data processing and interpretation:

    • Targeted analysis:

      • Focus on specific sterols and intermediates in the C4-demethylation pathway

      • Compare ratios of substrate:product pairs to assess enzyme activity

      • Monitor accumulation of 4α-methyl sterols as indicators of 3BETAHSD/D activity

    • Untargeted analysis:

      • Use multivariate statistical methods (PCA, PLS-DA) to identify patterns

      • Search for unexpected sterol species or pathway intermediates

      • Compare profiles across different tissues and developmental stages

  • Functional correlation:

    • Link specific sterol changes to observed phenotypes

    • Correlate membrane properties with sterol composition

    • Examine impacts on specific cellular processes (e.g., auxin transport)

This comprehensive approach allows researchers to not only identify changes in sterol profiles but also understand how these changes affect plant development and physiology .

How can researchers distinguish between direct and indirect effects of 3BETAHSD/D1 manipulation on plant development?

Distinguishing between direct and indirect effects of 3BETAHSD/D1 manipulation requires a multifaceted experimental approach:

  • Temporal analysis:

    • Use inducible expression/knockdown systems to determine immediate versus delayed effects

    • Track developmental processes chronologically after gene manipulation

    • Identify primary biochemical changes that precede phenotypic alterations

  • Molecular approaches:

    • Transcriptome analysis:

      • Compare gene expression changes at multiple time points after manipulation

      • Identify immediate transcriptional responses versus secondary adaptations

      • Use pathway enrichment to identify affected cellular processes

    • Metabolome analysis:

      • Focus on sterol intermediate accumulation as direct effects

      • Monitor changes in hormone levels as potential secondary effects

      • Examine broader metabolic alterations as adaptive responses

  • Complementation experiments:

    • Chemical complementation:

      • Test if providing specific sterols can rescue phenotypes

      • Apply hormone treatments to determine if developmental defects are hormone-related

      • Use inhibitors of specific pathways to isolate effects

    • Genetic complementation:

      • Use tissue-specific promoters to express the gene in specific cell types

      • Create chimeric enzymes with altered activity or localization

      • Perform rescue experiments with related enzymes from other species

  • Cellular and subcellular analyses:

    • Track changes in membrane properties (fluidity, organization)

    • Monitor protein trafficking and localization

    • Examine cytoskeletal organization and dynamics

  • Statistical modeling:

    • Use conditional independence testing to distinguish direct from indirect effects

    • Apply path analysis to model causal relationships between observed changes

    • Develop predictive models based on time-course data

By combining these approaches, researchers can build a causal network model that distinguishes primary effects of altered sterol biosynthesis from secondary developmental consequences .

What are common challenges in studying 3BETAHSD/D1 function and how can they be addressed?

Researchers face several challenges when studying 3BETAHSD/D1 function, with corresponding solutions:

  • Functional redundancy with 3BETAHSD/D2:

    • Challenge: Single mutants show no phenotype due to compensation

    • Solutions:

      • Generate double mutants with tissue-specific rescue constructs

      • Use inducible knockdown of both genes simultaneously

      • Employ CRISPR/Cas9 for precise genome editing of both genes

      • Consider analyzing subtle changes in single mutants under stress conditions

  • Membrane-associated protein expression and purification:

    • Challenge: Difficult to express and purify in active form

    • Solutions:

      • Optimize detergent selection for solubilization

      • Use mild non-ionic detergents (DDM, CHAPS)

      • Consider nanodiscs or styrene maleic acid lipid particles (SMALPs)

      • Express with fusion partners that enhance solubility

  • Complex sterol analysis:

    • Challenge: Difficult to separate and quantify similar sterol intermediates

    • Solutions:

      • Develop targeted MS/MS methods for specific sterols

      • Use multiple chromatographic approaches (reverse phase, normal phase)

      • Consider derivatization strategies to enhance separation

      • Implement internal standards for accurate quantification

  • Phenotypic subtlety or variability:

    • Challenge: Phenotypes may be opportunistic or environment-dependent

    • Solutions:

      • Standardize growth conditions rigorously

      • Increase biological replication

      • Implement quantitative phenotyping approaches

      • Examine plants under multiple environmental conditions

  • Distinguishing primary from secondary effects:

    • Challenge: Determining causal relationships in complex developmental processes

    • Solutions:

      • Use time-course experiments with high temporal resolution

      • Implement inducible systems for controlled gene manipulation

      • Combine with pharmacological approaches to test specific hypotheses

      • Use microscopy to track cellular events in real-time

Addressing these challenges requires integrated approaches that combine genetic, biochemical, and analytical techniques tailored to the specific aspects of 3BETAHSD/D1 function being investigated .

How can enzyme activity assays for recombinant 3BETAHSD/D1 be optimized for reliability and reproducibility?

Optimizing enzyme activity assays for recombinant 3BETAHSD/D1 requires attention to multiple factors:

  • Substrate preparation and handling:

    • Challenges: Sterol substrates are hydrophobic and prone to oxidation

    • Solutions:

      • Prepare fresh stock solutions in appropriate solvents (ethanol, DMSO)

      • Keep concentration of organic solvents <5% in assay

      • Store under nitrogen and protect from light

      • Include antioxidants where appropriate

      • Verify substrate purity by analytical methods before use

  • Optimized reaction conditions:

    ParameterOptimization ApproachTypical Range to Test
    pHTest range around physiological pHpH 6.5-8.5
    TemperatureBalance activity with stability25-37°C
    Ionic strengthVary salt concentration50-300 mM NaCl
    Cofactor (NAD+)Titrate to determine optimal concentration0.1-2 mM
    DetergentTest various types and concentrations0.01-0.1%
    TimeEnsure linearity of reaction5-60 minutes
  • Detection methods:

    • Spectrophotometric: Monitor NAD+ reduction at 340 nm

      • Pro: Real-time monitoring

      • Con: Less sensitive, interference possible

    • Chromatographic: HPLC or GC-MS analysis of substrate conversion

      • Pro: Direct product detection, higher specificity

      • Con: Labor-intensive, endpoint only

    • Radiometric: Using labeled substrates

      • Pro: High sensitivity

      • Con: Safety concerns, specialized equipment

  • Controls and validation:

    • Include heat-inactivated enzyme controls

    • Perform substrate and enzyme titrations

    • Validate with known inhibitors if available

    • Confirm product identity by MS

    • Determine kinetic parameters (Km, Vmax) under optimized conditions

  • Specific considerations for 3BETAHSD/D1:

    • Membrane association may require detergent or lipid reconstitution

    • Consider coupling to other enzymes in the C4-demethylation pathway

    • Monitor both dehydrogenase and decarboxylase activities

    • Test with physiologically relevant plant sterol substrates

By systematically optimizing these parameters and implementing appropriate controls, researchers can develop reliable and reproducible assays for 3BETAHSD/D1 enzyme activity .

What strategies can improve the expression of functional 3BETAHSD/D1 for structural studies?

Obtaining sufficient amounts of functional 3BETAHSD/D1 for structural studies presents several challenges. Here are strategic approaches to overcome them:

  • Expression system optimization:

    Expression SystemAdvantagesConsiderationsOptimization Strategies
    E. coliRapid, inexpensiveMay form inclusion bodiesUse specialized strains (C41/C43, Rosetta); lower temperature (16-20°C); solubility tags
    YeastEukaryotic processingLower yieldsOptimize codon usage; use strong inducible promoters; select appropriate strain
    Insect cellsHigh-quality proteinComplex, expensiveOptimize MOI; harvest timing; supplementation with sterols
    Plant expressionNative environmentLower yieldsUse strong viral promoters; transient expression systems
  • Construct design strategies:

    • Remove putative membrane-spanning regions if not essential for activity

    • Create fusion proteins with highly soluble partners (MBP, SUMO, Trx)

    • Include purification tags that can enhance solubility (His, GST)

    • Design truncated constructs focused on catalytic domains

    • Consider chimeric constructs with stable homologs from other species

  • Protein stabilization approaches:

    • Screen detergents systematically (from harsh to mild)

    • Test lipid nanodisc incorporation for membrane proteins

    • Add ligands or substrates during purification to stabilize active conformation

    • Include glycerol (5-10%) in buffers to enhance stability

    • Optimize buffer composition (pH, salt, additives)

    • Consider adding specific lipids that might be required for folding/function

  • Advanced techniques for structural studies:

    • Use FSEC (fluorescence-detection size exclusion chromatography) to rapidly screen constructs

    • Apply surface entropy reduction to enhance crystallizability

    • Consider antibody fragment co-crystallization to provide crystal contacts

    • Explore cryo-EM as an alternative to crystallography

    • Implement hydrogen-deuterium exchange mass spectrometry for dynamic studies

    • Use computational modeling based on homologous structures

  • Quality control metrics:

    • Develop activity assays to verify functional expression

    • Use SEC-MALS to assess homogeneity and oligomeric state

    • Implement thermal shift assays to evaluate stability

    • Verify proper folding using circular dichroism

    • Apply native MS to assess cofactor binding

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.