Recombinant Arabidopsis thaliana 4-hydroxybenzoate polyprenyltransferase, mitochondrial (PPT1)

Shipped with Ice Packs
In Stock

Description

Recombinant Arabidopsis thaliana 4-Hydroxybenzoate Polyprenyltransferase, Mitochondrial (PPT1): Overview

Recombinant Arabidopsis thaliana 4-hydroxybenzoate polyprenyltransferase, mitochondrial (PPT1) is a bioengineered enzyme derived from the model plant Arabidopsis thaliana. This protein is critical in ubiquinone (UQ) biosynthesis, functioning as a prenyltransferase that catalyzes the condensation of 4-hydroxybenzoate (4-HB) with polyprenyl diphosphate (PDP) to form intermediates essential for UQ production . The recombinant form is expressed in E. coli with an N-terminal His tag for purification and structural studies .

Biological Function and Mechanism

PPT1 is a rate-limiting enzyme in UQ biosynthesis, a pathway vital for electron transport in mitochondria . It exhibits broad substrate specificity for prenyl diphosphates (e.g., nonaprenyl diphosphate) and exclusively uses 4-HB as the aromatic substrate . In Arabidopsis, PPT1 is localized to mitochondria and plays a dual role in UQ synthesis and redox balance .

Critical Research Findings

  1. Mutant Phenotypes in Arabidopsis

    • cue1 (PPT1 loss-of-function): Causes reticulate leaves and stunted roots due to impaired PEP import into plastids. Reverse grafting experiments confirmed shoot and root phenotypes develop independently .

    • hrl1 (PPT1 mutation): Spontaneous HR-like lesions, enhanced pathogen resistance, and altered UQ/ubiquinol ratios. The L228F mutation disrupts enzyme activity without affecting mitochondrial localization .

  2. Mitochondrial Localization and Oxidative Stress

    • GFP fusion studies in S. pombe demonstrated PPT1 localizes to mitochondria, consistent with UQ biosynthesis occurring in this organelle .

    • S. pombe ppt1 mutants show sensitivity to H₂O₂ and Cu²⁺, requiring antioxidants (e.g., α-tocopherol) for survival, highlighting UQ’s antioxidant role .

Production and Purification

The recombinant PPT1 is expressed in E. coli and purified via affinity chromatography (His tag). The AA sequence spans 22–407 residues, including conserved motifs critical for catalytic activity .

Research Applications

  1. Enzymatic Assays:

    • Used to study substrate specificity and kinetic parameters of 4-HB prenylation.

    • Complementation assays in yeast coq2 mutants validate its functional equivalence .

  2. Mutant Analysis:

    • Overexpression of HRL1 in Arabidopsis elevates UQ levels, linking PPT1 activity to redox regulation .

Table 2: PPT1 Mutants in Arabidopsis

MutantPhenotypeBiochemical Impact
cue1Reticulate leaves, stunted rootsImpaired PEP import; reduced plastidial metabolism
hrl1HR-like lesions, pathogen resistanceAltered UQ/ubiquinol ratio; oxidative stress tolerance

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please communicate it to us, and we will prioritize the development of the specified tag.
Synonyms
PPT1; At4g23660; F9D16.130; 4-hydroxybenzoate polyprenyltransferase, mitochondrial; 4-HB polyprenyltransferase; 4HPT; 4-hydroxybenzoate nonaprenyltransferase; Para-hydroxybenzoate--polyprenyltransferase; PHB:PPT; PHB:polyprenyltransferase; Polyprenyltransferase 1; AtPPT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-407
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
Target Protein Sequence
PSSSSALLQSQHKSLSNPVTTHYTNPFTKCYPSWNDNYQVWSKGRELHQEKFFGVGWNYR LICGMSSSSSVLEGKPKKDDKEKSDGVVVKEASWIDLYLPEEVRGYAKLARLDKPIGTWL LAWPCMWSIALAADPGSLPSFKYMALFGCGALLLRGAGCTINDLLDQDIDTKVDRTKLRP IASGLLTPFQGIGFLGLQLLLGLGILLQLNNYSRVLGASSLLLVFSYPLMKRFTFWPQAF LGLTINWGALLGWTAVKGSIAPSIVLPLYLSGVCWTLVYDTIYAHQDKEDDVKVGVKSTA LRFGDNTKLWLTGFGTASIGFLALSGFSADLGWQYYASLAAASGQLGWQIGTADLSSGAD CSRKFVSNKWFGAIIFSGVVLGRSFQ
Uniprot No.

Target Background

Function
This protein catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. It mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis. This involves the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate. This protein is essential for embryo development.
Database Links

KEGG: ath:AT4G23660

UniGene: At.2563

Protein Families
UbiA prenyltransferase family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein; Matrix side.
Tissue Specificity
Expressed in flowers.

Q&A

What is PPT1 in Arabidopsis thaliana and what are its primary functions?

PPT1 in Arabidopsis thaliana has two distinct proteins that share the same abbreviation, which often creates confusion in the literature. The first is phosphoenolpyruvate/phosphate translocator 1, which functions primarily in photosynthetic processes by transporting phosphoenolpyruvate (PEP) across chloroplast membranes. The second is 4-hydroxybenzoate polyprenyltransferase, which is involved in mitochondrial processes.

The phosphoenolpyruvate/phosphate translocator PPT1 plays a crucial role in plant metabolism by facilitating the transport of PEP between cellular compartments. It shows lower specificity to PEP and higher permeability to 2-phosphoglycerate compared to PPT2, indicating functional differences despite some redundancy in their roles .

The 4-hydroxybenzoate polyprenyltransferase mitochondrial PPT1 is involved in the biosynthesis of ubiquinone (Coenzyme Q), catalyzing the prenylation of 4-hydroxybenzoate in the mitochondria .

How do PPT1 and PPT2 differ in expression patterns across plant tissues?

PPT1 and PPT2 exhibit distinct expression patterns across different tissues in Arabidopsis thaliana. Based on transcriptomic analyses, PPT1 generally shows higher expression levels than PPT2 across developmental stages. In C3 species including Arabidopsis, either PPT2 alone or both PPT1 and PPT2 together demonstrate high expression in leaf tissues, whereas PPT1 is predominantly expressed in root tissues, particularly in root tips .

The expression pattern differs in C4 species where the dominance of PPT1 versus PPT2 switches between leaf and root tissues and between mesophyll cells (MC) and bundle sheath cells (BSC). This differential expression suggests specialized roles for each transporter in different photosynthetic contexts .

Tissue TypePPT1 Expression in C3 PlantsPPT2 Expression in C3 PlantsPPT1 Expression in C4 PlantsPPT2 Expression in C4 Plants
LeafModerate to LowHighVariable (cell-type specific)Variable (cell-type specific)
RootHigh (especially in root tip)LowVariableVariable
BSCLow in C3PresentVariable across C4 speciesVariable across C4 species
MCNot applicable in C3Not applicable in C3Variable across C4 speciesVariable across C4 species

What are the optimal conditions for expression and purification of recombinant Arabidopsis thaliana PPT1?

For optimal expression and purification of recombinant Arabidopsis thaliana 4-hydroxybenzoate polyprenyltransferase (PPT1), E. coli serves as an effective heterologous expression system. The mature protein (amino acids 22-407) can be successfully expressed with an N-terminal His-tag to facilitate purification .

The recombinant protein is typically expressed in E. coli strains optimized for membrane protein expression, as PPT1 contains transmembrane domains. After cell lysis, purification via nickel affinity chromatography leveraging the His-tag yields protein of greater than 90% purity as determined by SDS-PAGE .

For long-term storage, the purified protein should be lyophilized or stored in buffer containing glycerol (recommended 5-50% final concentration, with 50% being standard). Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they compromise protein integrity .

What methodological approaches are most effective for studying PPT1 function in planta?

Several methodological approaches have proven effective for studying PPT1 function in planta:

  • Genetic complementation studies: The Arabidopsis thaliana PPT1 mutant cue1-5 (containing the R81C mutation) provides an excellent system for functional studies. This mutant exhibits a characteristic reticulate leaf phenotype and reduced rosette size. Expressing PPT1 variants driven by constitutive promoters (such as 35S) in the cue1-5 background allows for assessment of functional complementation .

  • GFP fusion proteins: Tagging PPT1 with GFP enables visualization of subcellular localization while maintaining functionality. Research has shown that PPT1-GFP fusions from different species successfully complement the cue1-5 phenotype, confirming that the fusion does not interfere with transport function .

  • Cross-species functional testing: Expressing PPT1 from species with different photosynthetic pathways (C3, C3-C4 intermediate, C4-like, and C4 plants) in Arabidopsis mutants provides insights into functional conservation and evolutionary adaptations of the transporter .

  • Domain analysis through deletion studies: Removal of specific domains (such as the 4x13-aa insertion found in C4 Flaveria bidentis PPT1) followed by functional testing can elucidate the role of specific protein regions in transporter function .

How has PPT1 evolved to support different photosynthetic pathways in plants?

The evolution of PPT1 across different photosynthetic pathways reveals intriguing adaptations. Phylogenetic analysis indicates that PPT1 underwent more amino acid changes than PPT2 during evolution, particularly in C4 lineages. A notable evolutionary modification is the acquisition of large insertions in PPT1 sequences in C4-like and C4 species of the Flaveria genus, consisting of four or five repeated 13-amino acid elements .

Interestingly, these insertions are not ubiquitous across all C4 species, suggesting multiple evolutionary paths to C4 photosynthesis. For example, while present in Flaveria C4 species, similar insertions were not observed in other C4 plants like Gynandropsis gynandra and Zea mays .

Functional studies indicate that despite these sequence changes, the fundamental PEP transport function remains conserved. When PPT1 from either C3 or C4 Flaveria species was expressed in the Arabidopsis cue1-5 mutant, both versions rescued the reticulate leaf phenotype, demonstrating functional conservation across photosynthetic types .

The insertions appear to be positioned in the outer membrane portion of the protein rather than in the functional transport path, potentially explaining why they do not disrupt basic transport functionality. This suggests that while sequence evolution occurred, the core transport mechanism has been preserved across photosynthetic lineages .

What are the molecular mechanisms behind PPT1's differential substrate specificity compared to PPT2?

The molecular mechanisms underlying PPT1's differential substrate specificity compared to PPT2 involve structural differences in their transmembrane domains and substrate-binding regions. While both transporters function to transport phosphoenolpyruvate (PEP), PPT1 demonstrates lower specificity to PEP and higher permeability to 2-phosphoglycerate than PPT2 .

The amino acid sequence analysis of PPT1 across species reveals more evolutionary changes compared to the more conserved PPT2, suggesting that PPT1 may have undergone adaptive modifications to accommodate varied metabolic demands in different plant lineages. These modifications likely affect binding pocket architecture and thus substrate recognition .

Protein structure prediction using tools like I-TASSER has shown that certain insertions found in C4 plant PPT1 (such as the 13-amino acid repeated elements in Flaveria bidentis) are located in the outer membrane portion of the protein rather than within the transmembrane transport channel. This positioning explains why such insertions do not disrupt basic transport functionality while potentially altering regulatory aspects or protein-protein interactions .

Further detailed structural studies are needed to fully elucidate how specific amino acid changes in PPT1 contribute to its distinct substrate specificity profile compared to PPT2.

How can researchers address the reticulate leaf phenotype in PPT1 mutants?

The reticulate leaf phenotype in PPT1 mutants (such as cue1-5 in Arabidopsis thaliana) presents a distinctive experimental system for researchers. This phenotype, characterized by dark-green veins on pale-green interveinal regions and reduced rosette size, results from phosphoenolpyruvate (PEP) transport deficiency in the chloroplast envelope .

To address this phenotype in research:

  • Genetic complementation: Express functional PPT1 genes under the control of constitutive promoters (e.g., 35S) or native promoters in the mutant background. Studies have shown that PPT1 from various species, including both C3 and C4 plants, can rescue the phenotype when expressed in cue1-5 mutants .

  • Domain-specific rescue: For structure-function studies, modified versions of PPT1 (such as versions with specific domains deleted) can be expressed to determine which protein regions are essential for rescuing the phenotype. For example, removing the 4x13-aa insertion from Flaveria bidentis (C4) PPT1 did not affect its ability to complement the cue1-5 phenotype, indicating this domain is not essential for basic PEP transport in Arabidopsis leaves .

  • Metabolic bypass strategies: Alternative metabolic pathways can sometimes compensate for PPT1 deficiency. Researchers can explore the introduction of enzymes that generate PEP through alternative routes within chloroplasts to bypass the need for PEP import.

  • Tissue-specific expression: Using tissue-specific promoters to drive PPT1 expression can help determine in which tissues PPT1 function is most critical for normal leaf development.

What are the most common challenges in purifying active recombinant PPT1 and how can they be overcome?

Purifying active recombinant PPT1 presents several challenges due to its membrane-associated nature and specific structural requirements. Common issues and solutions include:

  • Protein insolubility: As a membrane-associated protein, PPT1 tends to aggregate during extraction and purification. This can be addressed by:

    • Using mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin during extraction

    • Including glycerol (5-50%) in purification buffers to maintain protein stability

    • Optimizing extraction temperature (typically 4°C) to minimize denaturation

  • Maintaining protein activity: Recombinant PPT1 often loses activity during purification processes. To preserve functionality:

    • Minimize freeze-thaw cycles, as recommended in handling protocols

    • Store working aliquots at 4°C for short-term use (up to one week)

    • For long-term storage, use lyophilization or add 50% glycerol before storing at -20°C/-80°C

  • Expression system limitations: E. coli expression systems may not provide all post-translational modifications present in plant systems. Alternative approaches include:

    • Using plant-based expression systems for studies requiring native modifications

    • Exploring insect cell expression systems for improved folding of plant membrane proteins

    • Implementing co-expression of plant chaperones to assist proper folding

  • Protein verification challenges: Confirming proper folding and activity of purified PPT1 requires:

    • Developing reliable activity assays specific to PPT1's transport or enzymatic function

    • Using circular dichroism spectroscopy to verify secondary structure integrity

    • Employing size exclusion chromatography to confirm proper oligomeric state

How might detailed enzymatic studies of PPT1 contribute to our understanding of C4 photosynthesis evolution?

Detailed enzymatic studies of PPT1 could significantly advance our understanding of C4 photosynthesis evolution through several approaches:

  • Comparative kinetic analyses: Determining the substrate affinity, specificity, and transport rates of PPT1 from various C3, C3-C4 intermediate, and C4 species would reveal whether evolutionary changes in PPT1 sequences translate to functional adaptations that facilitate C4 photosynthesis. Current research suggests that while the basic PEP transport function is conserved, there may be subtle differences in catalytic properties that make C4 PPT1 more suitable for its specialized role .

  • Structure-function relationships: The observed amino acid modifications in PPT1 during C4 evolution, including the notable insertion with repeated 13-aa elements in some C4 species, warrant investigation into how these changes affect protein structure and function. While genetic complementation experiments show functional conservation, more detailed enzymological studies could reveal differences in transport efficiency, regulatory properties, or protein-protein interactions .

  • Cell-type specific functionality: The differential expression patterns of PPT1 between mesophyll cells and bundle sheath cells in C4 plants suggest specialized roles. Enzymatic studies focusing on cell-type specific isoforms could reveal adaptations that support the metabolic specialization required for C4 photosynthesis .

  • Evolution of substrate specificity: PPT1 shows lower specificity to PEP and higher permeability to 2-phosphoglycerate compared to PPT2, suggesting evolutionary selection for particular transport properties. Detailed analysis of how these properties vary across the C3-to-C4 continuum could illuminate the stepwise evolution of metabolite transport systems during C4 evolution .

What methodological innovations could improve the study of PPT1 structure-function relationships?

Several methodological innovations could significantly enhance our understanding of PPT1 structure-function relationships:

  • Cryo-electron microscopy (cryo-EM): This technique could provide high-resolution structural data for PPT1, including details about conformational changes during transport. Cryo-EM is particularly valuable for membrane proteins that are challenging to crystallize and could reveal how specific amino acid changes in C4 PPT1 affect transporter structure.

  • Advanced mutagenesis approaches: Combining systematic mutagenesis with high-throughput functional screening could identify critical residues for PPT1 function. Methods like deep mutational scanning, where thousands of variants are simultaneously assessed, could map the entire functional landscape of PPT1.

  • In situ transport assays: Developing techniques to measure PPT1 transport activity in native membrane environments (rather than in reconstituted systems) would provide more physiologically relevant functional data. Approaches like developing fluorescent reporters of PEP transport could enable real-time monitoring of transport in live cells.

  • Computational modeling and simulation: Molecular dynamics simulations of PPT1 variants from different photosynthetic types could predict how sequence changes affect transport mechanisms. These computational approaches could guide experimental design by highlighting regions of interest for functional testing.

  • Protein-protein interaction studies: Advanced techniques like proximity labeling or cross-linking mass spectrometry could identify PPT1 interaction partners that might differ between C3 and C4 species. Such differences could reveal how PPT1 is integrated into broader metabolic networks in different photosynthetic contexts.

  • Single-molecule techniques: Methods like single-molecule FRET (Förster Resonance Energy Transfer) could track conformational changes during substrate binding and transport, providing insights into how evolutionary changes affect the transport mechanism.

How should researchers design experiments to investigate PPT1's role in different plant tissues and cell types?

Designing experiments to investigate PPT1's role across different plant tissues and cell types requires multiple complementary approaches:

  • Cell-type specific expression analysis:

    • Utilize fluorescence-activated cell sorting (FACS) to isolate specific cell types (e.g., mesophyll cells vs. bundle sheath cells)

    • Implement laser-capture microdissection to collect tissue from precise leaf regions

    • Employ single-cell RNA sequencing to obtain high-resolution expression data across tissues

    • Compare expression patterns between C3 and C4 species to identify shifts in cellular localization

  • Tissue-specific functional analysis:

    • Develop tissue-specific promoter:PPT1 constructs to express PPT1 only in target tissues

    • Create tissue-specific CRISPR/Cas9 systems for conditional PPT1 knockout/knockdown

    • Use split-GFP complementation assays to visualize PPT1 interactions in specific cell types

    • Combine with metabolic profiling to link expression patterns to metabolic outcomes

  • Developmental time-course studies:

    • Implement inducible expression/suppression systems to manipulate PPT1 at specific developmental stages

    • Track phenotypic and metabolic changes during leaf development in wild-type vs. PPT1 mutants

    • Compare developmental expression patterns between C3 plants (like Arabidopsis) and C4 plants

  • Integration with environmental responses:

    • Analyze PPT1 expression and function under varying light conditions, CO2 levels, and temperatures

    • Investigate how different cell types modulate PPT1 expression in response to environmental cues

    • Examine how these responses differ between C3 and C4 species

What controls should be included when conducting genetic complementation studies with PPT1 variants?

When conducting genetic complementation studies with PPT1 variants, several essential controls should be included to ensure robust and interpretable results:

  • Positive controls:

    • Wild-type Arabidopsis thaliana plants to establish baseline phenotype

    • Complementation with native Arabidopsis PPT1 to confirm the rescue system functions properly

    • Known functional PPT1 variants that have previously demonstrated successful complementation

  • Negative controls:

    • Untransformed PPT1 mutant (e.g., cue1-5) to confirm the mutant phenotype

    • Empty vector transformants to control for transformation effects

    • Non-functional PPT1 variants with mutations in critical catalytic residues

  • Expression controls:

    • Include reporter gene constructs (e.g., GFP fusion) to verify expression and localization

    • Perform qRT-PCR and western blot analyses to confirm comparable expression levels across variants

    • Include constructs with different promoters (native vs. constitutive) to control for expression pattern effects

  • Functional validation:

    • Test multiple independent transgenic lines for each construct to control for position effects

    • Perform segregation analysis to confirm single-locus insertion

    • Conduct physiological measurements (e.g., photosynthetic parameters) to quantify functional rescue beyond visual phenotype

    • Include variants with known subtle functional differences to establish the sensitivity of the complementation assay

  • Domain-specific controls:

    • For domain deletion studies (like the ΔFbidPPT1 example), include partial deletions and point mutations to pinpoint functional regions

    • Test chimeric proteins combining domains from different species' PPT1 to identify species-specific functional elements

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.