Recombinant Arabidopsis thaliana 5'-adenylylsulfate reductase-like 5 (APRL5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes if needed. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with associated additional charges; please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
APRL5; At3g03860; F20H23.9; 5'-adenylylsulfate reductase-like 5; Adenosine 5'-phosphosulfate reductase-like 5; APR-like 5; AtAPRL5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-300
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
APRL5
Target Protein Sequence
SSPVDFSVCNYEFELFRFDLEAKCPPSLYPTPPIEVDGDSLDRLMASQHGNAYMSVLFYA SWCPFSRAVRPKFDMLSSMFPQIQHLAVEHSQALPSVFSRYGIHSLPSILMVNQTLNARY HGRKDLISLIEFYEEATGLQPVQYVAEGEPTGLNAGDGNLITWLRKGTSIREIFKQDPFL VLSLLFICLQMAILVFPIAESRMRALWASYVANLNLGRFGEISQLFNRGIHMVDVRRLWL KLSLVKTRNFHERAKNAQAWASSLASVSLGQTSSDQS
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G03860

STRING: 3702.AT3G03860.1

UniGene: At.18353

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is APRL5 and how does it relate to other APS reductase family members?

5'-Adenylylsulfate reductase-like 5 (APRL5) belongs to the APS reductase family in Arabidopsis thaliana, which plays crucial roles in sulfur metabolism. While APRL5 shares sequence homology with other APS reductase family members, it represents a distinct isoform with potentially specialized functions. The canonical APS reductase (such as APR1) catalyzes the reduction of activated sulfate to sulfite in the plant sulfur assimilation pathway .

APRL5, as a "-like" family member, may exhibit structural similarities to APR1 while potentially serving different physiological roles. Research on APR1 has demonstrated that it contains distinct functional domains, including an R domain (amino acids 73-327) homologous to microbial PAPS reductase, and a C domain (amino acids 328-465) homologous to thioredoxin . Comparable domain architecture analysis would be essential for characterizing APRL5's structure-function relationships.

What domains are typically found in APS reductase family members and what might this suggest about APRL5?

The APS reductase family typically contains two key domains with distinct functions, as demonstrated in APR1:

  • R domain (reductase domain): Homologous to microbial PAPS reductase, this domain is involved in substrate binding and catalysis but cannot function independently in APS reduction .

  • C domain (carboxyl-terminal domain): Homologous to thioredoxin, this domain exhibits glutaredoxin-like function and is involved in redox regulation .

These domains work cooperatively, as neither domain alone is sufficient for APS reduction activity, but partial activity can be restored when the domains are mixed together . APRL5 likely contains similar domain architecture, though potential variations in amino acid sequence might confer unique catalytic properties or substrate specificities that distinguish it from other family members.

How should researchers design experiments to characterize APRL5 enzymatic activity?

Designing rigorous experiments to characterize APRL5 enzymatic activity requires careful consideration of several factors:

  • Protein Expression and Purification: Express recombinant APRL5 with appropriate tags for purification while ensuring proper folding. Based on approaches with APR1, glutathione (GSH) dependency should be evaluated, as APR1 showed a Km[GSH] of approximately 0.6 mM .

  • Enzymatic Assay Design: Establish assays that can differentiate between potential activities:

    • APS reduction activity

    • GSH-dependent reduction of alternative substrates (hydroxyethyldisulfide, cystine, dehydroascorbate)

    • Reduction of insulin disulfides and ribonucleotide reductase

  • Domain Separation Studies: Consider expressing the R and C domains separately to assess their individual contributions to catalysis, following the approach used for APR1 .

  • Single-Subject Experimental Design Framework: Implement a rigorous experimental design that meets the standards outlined in the table below:

Design elementMeets standardsMeets standards, but with reservationsDoes not meet standards
Independent variable(s)Actively manipulated by researcherResearcher does not control changes to conditions
Dependent variable(s)Measured systematically over timeNo systematic measurement (e.g., anecdotal case study)
Measured by more than one assessorOnly one assessor
Includes interassessor agreement on at least 20% of data points in each phaseNo interassessor agreement, only in some phases, or in less than 20% of data points
Interassessor agreement meets minimal thresholdsPoor interassessor agreement
Length of phasesAt least 5 data points per phase3–4 points per phase< 3 points per phase
Replication of effectGeneral:< 3 replications

What approaches can be used to investigate the physiological role of APRL5 in planta?

To determine the physiological significance of APRL5 in Arabidopsis thaliana, researchers should consider multiple complementary approaches:

  • Reverse Genetics:

    • CRISPR/Cas9 knockout or knockdown lines

    • T-DNA insertion mutants

    • RNAi-mediated silencing

    • Overexpression lines

  • Natural Variation Analysis: The AMPRIL population provides an excellent resource for identifying natural allelic variations in APRL5 and their phenotypic consequences. This multi-parent RIL population allows for:

    • QTL analysis for complex traits

    • Testing QTL main effects

    • Evaluating QTL by background interactions

    • Assessing QTL by QTL interactions

  • Transcriptomic and Metabolomic Profiling: Compare wild-type and APRL5-modified plants under various conditions (e.g., sulfur deficiency, oxidative stress) to identify downstream effects on gene expression and metabolite levels.

  • Interactome Analysis: Identify protein interaction partners through yeast two-hybrid, co-immunoprecipitation, or proximity labeling approaches.

How can researchers effectively interpret data tables when analyzing APRL5 function?

When interpreting data tables from APRL5 experiments, researchers should follow these four systematic steps:

  • Identify Column Information: Examine column headings to understand what data is being recorded. Distinguish between independent variables (what was manipulated) and dependent variables (what was measured)4.

  • Analyze Independent Variables: Examine the first column (typically the independent variable) to identify what was changed in the experiment and look for patterns in these values4.

  • Analyze Dependent Variables: Examine each dependent variable column individually to identify patterns within each measured parameter4.

  • Evaluate Relationships Between Variables: Compare the independent variable column to each dependent variable column to determine if changing one variable affected others and to establish relationships between variables4.

For example, when analyzing APRL5 enzymatic activity under different substrate concentrations:

Substrate Concentration (mM)APRL5 Activity (nmol/min/mg)Glutathione Consumption (nmol/min)Redox State (ratio)
0.112.345.60.78
0.534.598.70.65
1.056.7156.20.52
2.078.9189.30.41
5.082.3194.50.39

When interpreting this hypothetical data table, researchers should note that as substrate concentration increases (independent variable), APRL5 activity and glutathione consumption increase while the redox state ratio decreases, suggesting direct relationships between these parameters.

How can natural variation in APRL5 be analyzed using advanced genetic resources?

Analyzing natural variation in APRL5 requires sophisticated genetic resources and statistical approaches:

  • Multi-Parent Recombinant Inbred Line Populations: The AMPRIL population in Arabidopsis provides an ideal framework for studying natural APRL5 variants. This population was developed by crossing eight founder accessions in a diallel scheme, followed by three generations of selfing .

  • Genotyping Approaches:

    • SNP markers

    • Microsatellite markers

    • Whole-genome resequencing for comprehensive variant detection

  • QTL Analysis Using Mixed-Model Methodology: This approach enables:

    • Testing for QTL main effects affecting APRL5 expression or activity

    • Identifying QTL by background interactions

    • Detecting QTL by QTL interactions that might influence APRL5 function

  • Residual Heterozygosity Exploitation: Because RILs in AMPRIL were genotyped in F4 and phenotyped in F5, residual heterozygosity can be leveraged to confirm and fine-map QTLs affecting APRL5 in the selfed progeny of lines containing such heterozygosity .

What genomic approaches can reveal the regulatory mechanisms controlling APRL5 expression?

Several genomic approaches can illuminate the regulatory mechanisms governing APRL5 expression:

  • Promoter Analysis: Identify transcription factor binding sites and regulatory elements in the APRL5 promoter region. Research on recombination in Arabidopsis has shown that events preferentially target non-methylated nucleosome-free regions at gene promoters, which showed significant enrichment of specific sequence motifs .

  • Chromatin Immunoprecipitation (ChIP) Studies: Identify proteins binding to the APRL5 regulatory regions under different conditions.

  • DNA Methylation Analysis: Characterize the methylation status of the APRL5 locus, as methylation patterns can significantly influence gene expression.

  • Chromosome Conformation Capture (3C/Hi-C): Determine if long-range chromatin interactions influence APRL5 regulation.

Data from such analyses can be organized in tables like this example of methylation status across different tissues:

Tissue TypeAPRL5 Promoter Methylation (%)APRL5 Gene Body Methylation (%)APRL5 Expression Level (FPKM)
Leaf12.345.678.9
Root34.552.345.6
Flower8.748.9102.3
Seed42.156.723.4
Stem18.950.267.8

How can researchers study recombination events affecting the APRL5 locus?

Studying recombination events at the APRL5 locus requires specialized approaches:

  • Tetrad Analysis: Resequencing the four products of meiotic tetrads, as demonstrated in Arabidopsis studies, can reveal the exact distribution of meiotic crossovers and gene conversions affecting the APRL5 locus .

  • Doubled Haploid Analysis: Using doubled haploids derived from Arabidopsis hybrids provides another approach to studying recombination events .

  • Gene Conversion Detection: Identify non-crossover associated gene conversions (NCOCTs) and crossover associated gene conversions (COCTs) at the APRL5 locus. Previous studies in Arabidopsis found that non-crossover associated GCs were extremely rare, likely due to their short average length of ~25–50 bp .

  • Recombination Site Analysis: Examine whether recombination sites near APRL5 correlate with features such as GC content, as has been observed in animal and fungal genomes, where recombination sites have been shown to correlate with high GC content .

What methods are most effective for studying the redox regulation of APRL5?

Based on studies of related APS reductase family members, several methods can be employed to study APRL5 redox regulation:

  • Glutathione Dependency Assays: Evaluate APRL5's dependence on glutathione as a hydrogen donor. APR1 demonstrates efficient use of GSH with a Km[GSH] of approximately 0.6 mM in APS reduction .

  • Activity Assays with Alternative Substrates: Test APRL5's activity in GSH-dependent reduction of:

    • Hydroxyethyldisulfide

    • Cystine

    • Dehydroascorbate

    • Insulin disulfides

    • Ribonucleotide reductase

  • Complementation Studies: Test APRL5's ability to substitute for glutaredoxin in vivo through complementation of appropriate E. coli mutants, similar to how the C domain of APR1 was shown to substitute for glutaredoxin .

  • Domain Functionality Analysis: Express and test separate domains of APRL5 to determine their individual and combined activities in various redox reactions .

How should researchers interpret contradictory data regarding APRL5 activity?

When confronted with contradictory data about APRL5 activity, researchers should:

How can APRL5 research contribute to understanding plant sulfur metabolism?

APRL5 research can provide significant insights into plant sulfur metabolism through:

  • Pathway Integration Analysis: Determine how APRL5 functions within the broader sulfur assimilation pathway and whether it serves redundant or specialized roles compared to canonical APS reductases.

  • Stress Response Studies: Characterize how APRL5 expression and activity change in response to:

    • Sulfur deficiency

    • Oxidative stress

    • Heavy metal exposure

    • Pathogen attack

  • Evolutionary Analysis: Compare APRL5 across different plant species to understand the evolutionary diversification of APS reductase family members and their specialized functions.

  • Metabolic Engineering Applications: Explore how modulation of APRL5 activity might be leveraged to enhance:

    • Sulfur use efficiency

    • Production of sulfur-containing defense compounds

    • Tolerance to environmental stresses

What considerations are important when designing CRISPR/Cas9 approaches for APRL5 modification?

When designing CRISPR/Cas9 strategies for APRL5 modification, researchers should consider:

  • Guide RNA Selection:

    • Target specificity to avoid off-target effects on other APS reductase family members

    • Efficiency of guide RNAs based on target sequence composition

    • Accessibility of target sites in the chromatin context

  • Modification Strategy:

    • Complete knockout vs. specific domain modifications

    • Promoter modifications for altered expression patterns

    • Base editing for specific amino acid changes

  • Screening Strategy:

    • PCR-based genotyping approaches

    • Activity assays to confirm functional consequences

    • Phenotypic screening under relevant conditions (e.g., sulfur limitation)

  • Genetic Background Considerations:

    • Consider using the diverse accessions available in resources like AMPRIL to evaluate the effects of APRL5 modifications across different genetic backgrounds

    • Test for potential QTL by background interactions that might influence the phenotypic outcome of APRL5 modifications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.