Recombinant Arabidopsis thaliana ABC transporter B family member 23, mitochondrial (ABCB23)

Shipped with Ice Packs
In Stock

Description

Introduction to ABC Transporters in Plants

ATP-binding cassette (ABC) transporters constitute one of the largest protein families found across all living organisms, from bacteria to humans and plants. In plants, these transmembrane proteins facilitate the movement of various substances across cellular membranes, utilizing energy from ATP hydrolysis. The ABC transporter superfamily is divided into several subfamilies (A through G), each with distinct functional characteristics and subcellular localizations .

In Arabidopsis thaliana, a model organism extensively used in plant molecular biology, ABC transporters play crucial roles in numerous physiological processes. These include hormone transport, lipid translocation, detoxification, and defense against pathogens. The B subfamily of ABC transporters (ABCB) in plants primarily consists of both full and half transporters that contribute to various cellular functions .

Classification and Nomenclature

ABC transporters are classified based on their domain organization and sequence homology. The B subfamily in Arabidopsis thaliana includes both full transporters (containing two nucleotide-binding domains and two transmembrane domains) and half transporters (containing one nucleotide-binding domain and one transmembrane domain) that may function as homo- or heterodimers .

ABCB23, also known as ATP-binding cassette B23, ATATM1, or simply ATM1, belongs to the group of mitochondrial ABC transporters in Arabidopsis thaliana . The nomenclature "ATM" stands for "ABC transporter of the mitochondrion," indicating its subcellular localization and functional categorization.

Genetic Information

ABCB23 is encoded by the gene AT4G28630 in the Arabidopsis thaliana genome. This gene is also identified by the secondary identifier locus:2139875 . In the Arabidopsis Information Resource (TAIR), the gene is annotated as "ABC transporter of the mitochondrion 1" and has several aliases including ABCB23, ATATM1, and ATM1 .

The detailed genetic information of ABCB23 is summarized in the following table:

ParameterInformation
DB IdentifierAT4G28630
Secondary Identifierlocus:2139875
NameATP-binding cassette B23
Brief DescriptionABC transporter of the mitochondrion 1
TAIR AliasesABCB23, ATATM1, ATM1

Recombinant ABCB23 Protein

The recombinant form of Arabidopsis thaliana ABCB23 has been successfully expressed in E. coli expression systems, providing a valuable tool for studying this protein's structure and function. The recombinant protein typically includes amino acids 71-678 of the full-length sequence and is often fused with a histidine tag to facilitate purification and detection .

Production and Expression Systems

Recombinant ABCB23 protein can be produced using bacterial expression systems, particularly Escherichia coli. The gene sequence encoding for amino acids 71-678 of the ABCB23 protein is cloned into suitable expression vectors, allowing for the inducible expression of the protein in bacterial cells. The inclusion of an N-terminal histidine tag facilitates efficient purification using metal affinity chromatography techniques .

After expression, the recombinant protein is typically purified to greater than 90% homogeneity as determined by SDS-PAGE analysis. The purified protein is then lyophilized to improve stability during storage and shipping .

Functional Role of ABCB23

As an ABC transporter localized in the mitochondria, ABCB23 (ATM1) is believed to be involved in the transport of substances across mitochondrial membranes, although its exact substrate specificity and functional significance remain somewhat unclear.

Mitochondrial Transport Function

By analogy with other mitochondrial ABC transporters, particularly those in the ABCB subfamily, ABCB23 may play a role in the transport of iron-sulfur clusters or their components across the mitochondrial membrane. This function is critical for various cellular processes, as iron-sulfur clusters serve as essential cofactors for many proteins involved in electron transport, enzyme catalysis, and redox reactions .

Comparison with Other ATM Transporters

Among the three ATM transporters in Arabidopsis thaliana (ATM1/ABCB23, ATM2, and ATM3), ATM3 appears to have the most critical function for plant growth . This suggests that ABCB23, while present in the plant, may have redundant functions or plays a less essential role in plant development and physiology compared to ATM3.

The specific substrates transported by ABCB23 and the physiological conditions under which this transporter is most active remain areas for further investigation. Understanding the functional differences between ABCB23 and other mitochondrial ABC transporters could provide valuable insights into the specialized roles of these proteins in plant cells.

Research Applications and Significance

Recombinant Arabidopsis thaliana ABCB23 protein serves as a valuable tool for various research applications in plant molecular biology and biochemistry.

Comparative Analysis with Other ABC Transporters

Comparative studies between ABCB23 and other ABC transporters, particularly those from different subfamilies or organisms, can reveal evolutionary relationships and functional diversification within this large protein family. By analyzing the structural and functional similarities and differences between ABCB23 and related transporters, researchers can gain insights into the specialized adaptations of these proteins for different substrates and cellular compartments.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ABCB23; ATM1; STA2; At4g28630; T5F17.80; ABC transporter B family member 23, mitochondrial; ABC transporter ABCB.23; AtABCB23; ABC transporter of the mitochondrion 1; AtATM1; Iron-sulfur clusters transporter ATM1; Protein STARIK 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
71-678
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ABCB23
Target Protein Sequence
NQDQTKTASSKKILRTISSYLWMKDNPELRFRVIAALACLIGAKFLNVQVPFLFKLSIDL LSSYSSSTITDSNPYLLAAFATPSSVLIGYGIARSGSSAFNELRTAVFSKVSLRTIRSVS RKVLSHLHDLDLRYHLNRETGALNRIIDRGSRAINTILSAMVFNVVPTILEISMVTGILA YNFGPVFALITSLSVGSYIAFTLVVTQYRTKFRKAMNQADNDASTRAIDSLVNYETVKYF NNEDYEARKYDDLLGRYEDAALQTQKSLAFLDFGQSFIFSTALSTSMVLCSQGIMNGEMT VGDLVMVNGLLFQLSLPLYFLGGVYRETVQGLVDMKSLFQLLEERSDIGDKDTETKLPPL VLRGGSISFENVHFSYLPERKILDGISFEVPAGKSVAIVGSSGSGKSTILRMIFRFFDTD SGNVRIDGQDIKEVTLESLRSCIGVVPQDTVLFNDTIFHNIHYGNLSATEEEVYDAARRA VIHDTIMKFPDKYSTAVGERGLMLSGGEKQRVALARAFLKSPAILLCDEATNALDSKTEA EIMKTFRSLASNRTCIFIAHRLTTAMQCDEIIVMEKGKVVEKGTHQVLLEKSGRYAKLWT QQNSTLEV
Uniprot No.

Target Background

Function
Plays a crucial role in the generation of cytoplasmic iron-sulfur proteins by facilitating the export of Fe/S cluster precursors synthesized by NFS1 and other mitochondrial proteins. It is not involved in the export of cyclic pyranopterin monophosphate (cPMP) from mitochondria into the cytosol.
Gene References Into Functions
  1. These data suggest that ATM1 functions differently in various root cells and may be involved in distinct stages of endocytosis, both brefeldin A-sensitive and insensitive pathways, endoplasmic reticulum tethering, and plasmodesmatal activity. PMID: 18179725
Database Links

KEGG: ath:AT4G28630

STRING: 3702.AT4G28630.1

UniGene: At.22656

Protein Families
ABC transporter superfamily, ABCB family, Heavy Metal importer (TC 3.A.1.210) subfamily
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots, leaves, stems, flowers and siliques.

Q&A

What are the structural characteristics of ABCB23?

ABCB23 is a mitochondrial membrane protein with a full amino acid sequence that includes characteristic domains of ABC transporters. The expression region spans amino acids 71-678, containing nucleotide-binding domains (NBDs) that bind and hydrolyze ATP, and transmembrane domains (TMDs) that form the substrate translocation pathway . Like other ABC transporters, ABCB23 likely has a conserved structure with NBDs located in the mitochondrial matrix and TMDs embedded in the inner mitochondrial membrane.

How does ABCB23 differ from other ABC transporters in Arabidopsis thaliana?

ABCB23 is specifically localized to the mitochondria, distinguishing it from many other ABC transporters that localize to the plasma membrane, vacuole, or other cellular compartments. It belongs to the B subfamily (ABCB) that typically functions in mitochondrial transport processes. While other ABC transporters such as ABCC3 have been implicated in responses to chemicals like bleomycin , ABCB23's mitochondrial localization suggests a specialized role in transport processes critical for mitochondrial function and potentially in defense mechanisms .

What are the most effective methods for recombinant expression of ABCB23?

While specific ABCB23 expression protocols are not detailed in the search results, insights can be drawn from successful approaches with similar proteins. Bacterial expression systems, particularly E. coli, can be effective for producing mitochondrial ABC transporters, as demonstrated with human mitochondrial ABC transporters . For ABCB23 expression, researchers should consider:

  • Codon optimization for the expression system

  • Use of strong inducible promoters (e.g., T7)

  • Selection of appropriate fusion tags to enhance solubility and facilitate purification

  • Growth at lower temperatures (16-20°C) after induction to improve proper folding

The expression region (amino acids 71-678) should be targeted to exclude potential mitochondrial targeting sequences that might interfere with proper folding .

What purification strategies yield the highest quality ABCB23 protein for structural and functional studies?

Based on successful approaches with similar membrane transporters, a multi-step purification strategy is recommended:

  • Membrane isolation by differential centrifugation

  • Solubilization using mild detergents (e.g., DDM, LMNG)

  • Affinity chromatography utilizing fusion tags (His, GST, or FLAG)

  • Size exclusion chromatography for final polishing

For structural studies, reconstitution into lipid nanodiscs has proven effective for similar ABC transporters, stabilizing the protein in a native-like lipid environment while removing detergent . This approach allows for maintaining ATPase activity comparable to that observed in other ABC transporters.

Purification StepTypical ConditionsCritical Considerations
Membrane Isolation100,000×g, 1 hourBuffer composition containing glycerol and protease inhibitors
Solubilization1-2% detergent, 4°C, 1-2 hoursSelection of detergent critical for maintaining structure
Affinity ChromatographyImidazole gradient for His-tagged proteinsSlow flow rates to maximize binding
Size ExclusionSuperdex 200, flow rate 0.5 ml/minBuffer should contain low concentration of detergent
Nanodisc ReconstitutionMSP1D1:protein:lipid ratio optimizationLipid composition affects stability and activity

How can ATPase activity of ABCB23 be reliably measured?

ATPase activity is a key functional parameter for ABC transporters. For ABCB23, methods similar to those used for other transporters can be applied:

  • Coupled enzyme assays (pyruvate kinase/lactate dehydrogenase) to monitor ATP hydrolysis via NADH oxidation

  • Malachite green assay to measure released inorganic phosphate

  • Radiolabeled ATP assays for highest sensitivity

When establishing these assays, researchers should account for potential background ATPase activity and optimize reaction conditions (pH, temperature, ionic strength). Measurements of ABCB10 produced in E. coli showed ATP hydrolysis rates similar to other human ABC transporters, suggesting that recombinant plant mitochondrial transporters may display comparable activities when properly purified .

What is known about the substrate specificity of ABCB23?

While the specific substrates of ABCB23 are not directly reported in the search results, research on other plant ABC transporters provides context. As a mitochondrial transporter, ABCB23 likely transports compounds essential for mitochondrial function. By analogy with other ABC transporters, potential substrates might include:

  • Metabolites required for mitochondrial processes

  • Potentially toxic compounds that need to be exported from the mitochondria

  • Signaling molecules involved in mitochondrial stress responses

Understanding substrate specificity would require transport assays using reconstituted protein in liposomes or nanodiscs, testing candidate substrates based on metabolomic analysis of abcb23 mutants compared to wild-type plants .

What approaches are most effective for generating and validating ABCB23 knockout or overexpression lines?

For comprehensive functional analysis, both loss-of-function and gain-of-function genetic resources are valuable:

  • Knockout lines:

    • T-DNA insertion lines from established Arabidopsis stock centers

    • CRISPR/Cas9-mediated gene editing targeting conserved NBD regions

    • Verification by RT-PCR, Western blotting, and phenotypic analysis

  • Overexpression lines:

    • Constitutive expression under CaMV 35S promoter

    • Inducible expression systems for temporal control

    • Tissue-specific promoters for spatial control

    • Confirmation by qRT-PCR and protein quantification

When analyzing phenotypes, researchers should consider stress conditions relevant to mitochondrial function, including oxidative stress and responses to pathogens, as ABC transporters have been implicated in stress tolerance and defense responses .

What phenotypes are associated with altered ABCB23 expression?

While specific phenotypes for ABCB23 mutants are not detailed in the search results, research on related ABC transporters suggests several areas to investigate:

  • Mitochondrial function: Altered respiratory rates, ATP production, reactive oxygen species generation

  • Stress responses: Changed tolerance to oxidative, temperature, or pathogen stress

  • Growth and development: Potential impacts on germination, growth rate, or flowering time

  • Defense responses: Modified susceptibility to pathogens, as seen with other ABC transporters involved in plant defense

For example, overexpression of another Arabidopsis ABC transporter (ACBP3) enhances NPR1-dependent plant defense responses, suggesting that ABCB23 might similarly influence pathogen resistance pathways .

How can structural studies of ABCB23 inform its functional mechanism?

Structural determination of ABCB23 would provide crucial insights into its transport mechanism. Approaches include:

  • X-ray crystallography: Requires highly purified, homogeneous, and stable protein preparations, potentially facilitated by stability-enhancing mutations or binding partners

  • Cryo-electron microscopy: Increasingly powerful for membrane proteins, allowing visualization in different conformational states

  • Computational modeling: Homology modeling based on related transporters with known structures

Structural information would reveal the substrate-binding pocket, conformational changes during transport cycle, and potential regulatory sites. This knowledge could inform directed mutagenesis studies to probe specific mechanistic hypotheses .

What role might ABCB23 play in plant responses to environmental stresses?

Based on knowledge of other ABC transporters, ABCB23 likely contributes to stress responses. Research approaches to explore this include:

  • Comparing wild-type and mutant plants under various stress conditions (drought, temperature extremes, pathogen exposure)

  • Transcriptomic and metabolomic analyses to identify changes in stress-response pathways

  • Investigation of potential signaling roles in mitochondria-to-nucleus communication during stress

Research on other ABC transporters shows they can be induced by stresses and contribute to stress tolerance. For example, ABCC3 expression is induced by bleomycin treatment via the ATM kinase and SOG1 transcription factor, key regulators of DNA damage response . Similar signaling pathways might regulate ABCB23 during stress.

How does ABCB23 compare to homologous transporters in other plant species?

Comparative genomic analysis can reveal evolutionary conservation and specialization of ABCB23:

  • Identification of homologs in other plant species through sequence similarity searches

  • Phylogenetic analysis to determine evolutionary relationships

  • Expression pattern comparison across species to identify conserved regulation

  • Functional complementation studies to test for conserved molecular function

This comparative approach can identify highly conserved residues likely critical for function and species-specific adaptations that might relate to environmental niches or metabolic differences.

What interactions exist between ABCB23 and other cellular components?

Understanding the protein interaction network of ABCB23 is critical for elucidating its cellular roles:

  • Co-immunoprecipitation followed by mass spectrometry to identify interaction partners

  • Yeast two-hybrid or split-ubiquitin assays for direct protein interactions

  • Bimolecular fluorescence complementation to confirm interactions in planta

  • Genetic interaction studies through double mutant analysis

Potential interactors might include other mitochondrial proteins involved in metabolism, proteins mediating mitochondrial stress responses, or components of retrograde signaling pathways that communicate mitochondrial status to the nucleus.

How can ABCB23 research inform strategies for improving plant stress tolerance?

Understanding ABCB23 function opens possibilities for biotechnological applications:

  • Targeted overexpression to potentially enhance stress tolerance

  • Identification of compounds that modulate ABCB23 activity to prime stress responses

  • Use of ABCB23 promoter elements as stress-responsive regulatory components in synthetic biology applications

Research on other ABC transporters indicates their potential in stress tolerance engineering. For example, the finding that ABCC3 contributes to bleomycin resistance suggests that modulating ABC transporter expression could enhance tolerance to various stresses .

What experimental design strategies are most effective for studying ABCB23 in the context of causal networks?

Understanding ABCB23's role within cellular networks requires sophisticated experimental design:

  • ABCD-Strategy (Budgeted Experimental Design for Targeted Causal Structure Discovery) provides a framework for optimizing experimental interventions to discover causal relationships

  • Time-course experiments to capture dynamic responses and regulatory relationships

  • Multi-omics integration combining transcriptomics, proteomics, and metabolomics data

  • Network analysis to place ABCB23 within broader cellular pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.