Recombinant Arabidopsis thaliana ABC transporter B family member 24, mitochondrial (ABCB24)

Shipped with Ice Packs
In Stock

Description

Classification and Identification

ABCB24 is classified as a member of the ATP-binding cassette (ABC) transporter B subfamily found in Arabidopsis thaliana, commonly known as thale cress or mouse-ear cress. It is specifically localized to the mitochondria and is characterized by its ability to facilitate transport across mitochondrial membranes . The protein is identified in databases under UniProt accession number Q9M0G9 and is encoded by the gene AT4G28620 . This transporter represents an important component of the highly expanded ABC transporter family in higher plants, which displays greater diversity compared to mammalian systems .

Nomenclature and Genetic Context

ABCB24 is also known by several alternative names including ATATM2 and ATM2 (ABC transporter of the mitochondrion 2) . It belongs to a family of three ATM genes in Arabidopsis thaliana: ATM1, ATM2, and ATM3. Interestingly, research indicates that only ATM3 plays a significant role in plant growth, suggesting that ABCB24/ATM2 may have more specialized or redundant functions . The protein is classified as a half-molecule ABC transporter, indicating its structural organization and functional mechanism .

Protein Architecture

The mature ABCB24 protein comprises amino acids 76-680 of the full protein sequence . Like other ABC transporters, ABCB24 contains characteristic nucleotide-binding domains (NBDs) that bind and hydrolyze ATP, providing the energy necessary for substrate transport across membranes. The protein also contains transmembrane domains that form the pathway through which substrates are transported. As a half-molecule transporter, ABCB24 likely requires dimerization to form a functional transport unit, a common feature among certain ABC transporter subfamilies.

Subcellular Localization

As indicated by its name, ABCB24 is specifically localized to the mitochondria in Arabidopsis thaliana cells . This localization is crucial for its function, as it enables the protein to participate in transport processes across mitochondrial membranes. The targeting of ABCB24 to mitochondria likely involves specific N-terminal targeting sequences that direct the protein to this organelle during or after translation.

Transport Mechanism

Like other ABC transporters, ABCB24 is expected to function through an ATP-dependent mechanism. The binding and hydrolysis of ATP at the nucleotide-binding domains induce conformational changes in the protein, which facilitate the movement of substrates across the mitochondrial membrane. This process typically involves alternating access of the substrate-binding site between the two sides of the membrane, allowing unidirectional transport against concentration gradients.

Relation to Other Plant ABC Transporters

The ABC transporter family in higher plants is highly expanded compared to mammalian systems, and certain members of the plant ABCB subfamily display very high substrate specificity . This contrasts with many mammalian ABC transporters that often function in multi-drug resistance phenomena with broader substrate ranges. ABCB24, as a member of this subfamily, may therefore exhibit specialized transport functions within plant mitochondria.

Comparative Analysis with Other ATM Proteins

Among the three ATM proteins in Arabidopsis (ATM1, ATM2, and ATM3), only ATM3 has been identified as having a significant function for plant growth . This suggests that ABCB24/ATM2 may have a more specialized or redundant role in plant metabolism. Understanding the functional distinctions between these related transporters requires further investigation, particularly regarding their substrate specificities and physiological roles.

Expression Systems

Recombinant ABCB24 can be successfully produced using Escherichia coli expression systems . The mature protein (amino acids 76-680) is typically expressed with an N-terminal His-tag to facilitate purification and detection . This approach allows for the production of sufficient quantities of the protein for research and biochemical analyses. The expression in bacterial systems provides advantages in terms of yield, cost-effectiveness, and scalability.

Purification and Quality Control

His-tagged recombinant ABCB24 can be purified using standard affinity chromatography techniques that exploit the interaction between the His-tag and metal ions like nickel or cobalt. Following purification, the quality of the protein is typically assessed using SDS-PAGE, with purity levels generally exceeding 85-90% . This high level of purity ensures that the recombinant protein is suitable for various downstream applications, including structural and functional studies.

Functional Characterization

Purified recombinant ABCB24 can be employed in various functional assays to determine its substrate specificity, transport kinetics, and ATP hydrolysis activity. Such studies are essential for understanding the physiological role of ABCB24 in plant cells and can provide insights into its potential contributions to plant metabolism, stress responses, or development. Liposome reconstitution systems or membrane vesicle assays are commonly used approaches for investigating transport activities.

Post-translational Regulation Studies

Research on ABC transporters has revealed that their function is often regulated by post-translational modifications, particularly protein phosphorylation . Studies comparing plant and mammalian ABC transporters have shown a surprisingly high degree of similarity in their regulatory mechanisms . Recombinant ABCB24 can serve as a substrate for investigating such regulatory modifications and their effects on transport activity, providing insights into the integration of ABCB24 function with cellular signaling pathways.

Protein Phosphorylation

ABC transporters exhibit an evolutionarily conserved but complex regulation by protein phosphorylation . This regulation appears to involve specific regulatory domains that connect the nucleotide-binding folds. While specific information about ABCB24 phosphorylation is not directly provided in the available studies, its membership in the ABC transporter family suggests that similar regulatory mechanisms may apply. Investigating these phosphorylation events could provide important insights into how ABCB24 activity is modulated in response to cellular conditions.

Protein-Protein Interactions

The function of ABC transporters is often influenced by interactions with other proteins. In both plants and mammals, ABC transporters physically interact with chaperone proteins such as heat shock protein 90 (Hsp90) and FK506-binding proteins that facilitate their proper localization to target membranes . These protein-protein interactions appear to be tightly connected with phosphorylation events, suggesting a coordinated regulatory mechanism. The specific interaction partners of ABCB24 and their functional significance remain areas for further investigation.

Substrate Identification

A critical area for future research is the identification of the specific substrates transported by ABCB24 across the mitochondrial membrane. This information would provide significant insights into the physiological role of this transporter and its contribution to mitochondrial function in plant cells. Techniques such as metabolomics, transport assays with radiolabeled compounds, or genetic approaches could be employed to address this question.

Functional Genomics

Genetic manipulation of ABCB24 expression in Arabidopsis thaliana, through knockout, knockdown, or overexpression approaches, could help elucidate its physiological significance. Phenotypic analysis of such genetic variants under various growth conditions could reveal the contributions of ABCB24 to plant development, stress responses, or metabolic processes. These studies would complement the biochemical characterization of the recombinant protein.

Comparative Analysis Across Species

Investigating ABCB24 homologs in other plant species could provide evolutionary insights and potentially reveal conserved or divergent functions. Such comparative studies might identify species-specific adaptations in mitochondrial transport processes and contribute to our understanding of plant evolution and adaptation to different environmental conditions.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ABCB24; ATM2; STA3; At4g28620; T5F17.70; ABC transporter B family member 24, mitochondrial; ABC transporter ABCB.24; AtABCB24; ABC transporter of the mitochondrion 2; AtATM2; Iron-sulfur clusters transporter ATM2; Protein STARIK 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
76-680
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ABCB24
Target Protein Sequence
HPEKINRTSSENILRMISSYLWMKDNPKLCFRVISAFACLVGAKFLNVQVPFLFKVAIDW LSSSSFVDSNPYLVAAFATPSSVLIGYGIARSGSSAFNELRTSVFSKVALRTIRTISRKV LSRLHDLDLRYHLNRDTGALNRIIDRGSRAINTILSAMVFNIMPTILEISMVSCILAYKF GAVYALITCLSVGSYIAFTLAMTQWRIKIRKAMNEAENDASTRAIDSLINYETVKYFNNE DYEARKYDQLHENYEDAALQSRKSFALLNFGQSFIFSTALSTAMVLCSQGIMNGQMTVGD LVMVNGLLFQLSLPLYFLGVVYSDTVQGLVDMKSMFKFLEERSDIGDKDIDRKLPPLVLK GGSISFENVHFSYLPERKILDGISFEVPAGKSVAIVGSSGSGKSTILRMIFRFFDVDSGN VKIDGQDIKEVRLESLRSSIGVVPQDTVLFNDTIFHNIHYGNLSATEEEVYNAARRAAIH DTIMKFPDKYSTAVGERGLMLSGGEKQRVALARAFLKSPAILLCDEATSALDSKTEAEIM KTLRSLASNRTCIFIAHRLTTAMQCDEILVMEKGKVVEKGTHEVLLGKSGRYAKLWTQQN SKLEV
Uniprot No.

Target Background

Function
ABCB24 plays a crucial role in the generation of cytoplasmic iron-sulfur proteins. It mediates the export of Fe/S cluster precursors synthesized by NFS1 and other mitochondrial proteins. Importantly, it is not involved in the export of cyclic pyranopterin monophosphate (cPMP) from mitochondria to the cytosol.
Database Links

KEGG: ath:AT4G28620

STRING: 3702.AT4G28620.1

UniGene: At.4526

Protein Families
ABC transporter superfamily, ABCB family, Heavy Metal importer (TC 3.A.1.210) subfamily
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Mostly expressed at low levels in roots and flowers.

Q&A

What is ABCB24 and how does it relate to other ABC transporters in Arabidopsis?

ABCB24 is a mitochondrial ATP-binding cassette transporter belonging to the B subfamily of ABC transporters in Arabidopsis thaliana. ABC transporters constitute one of the largest protein families and are involved in the transport of various substrates across cellular membranes. While ABCB24 specifically localizes to mitochondria, other ABC transporters in Arabidopsis show different subcellular localizations and functions. For instance, ABCC3 contributes to bleomycin resistance , ABCB4 regulates cellular auxin levels in a concentration-dependent manner , and ABCC4 functions as a cytokinin efflux transporter influencing root development and stomatal opening .

To study ABCB24's relationship with other transporters, researchers should employ phylogenetic analysis of the complete Arabidopsis ABC transporter family, combined with subcellular localization studies using fluorescent protein fusions. Comparative expression analysis through RT-qPCR across different tissues, similar to the approach used for ABCC4 , will further elucidate functional relationships.

What methods are most effective for expressing recombinant ABCB24 in experimental systems?

For successful expression of recombinant ABCB24, researchers should consider:

  • Expression systems: Based on experiences with other ABC transporters, heterologous expression in Saccharomyces cerevisiae has proven effective, as demonstrated with ABCC4 . Alternative systems include bacterial expression (E. coli), insect cells (Sf9), or plant expression systems.

  • Construct design: Include appropriate promoters (constitutive or inducible), targeting sequences to ensure mitochondrial localization, and epitope tags for detection and purification. The β-estradiol-inducible system used for ABCC4 provides excellent control over expression timing .

  • Verification methods: Confirm expression through Western blotting (as done for ABCC4, detecting a 169 kDa band ), immunolocalization, and functional assays.

Table 1: Comparison of Expression Systems for Recombinant ABCB24

Expression SystemAdvantagesLimitationsRecommended Applications
S. cerevisiaeEukaryotic processing, membrane insertion capability, transport assay compatibilityLower yield than bacterial systemsTransport activity studies, substrate identification
E. coliHigh yield, rapid growth, cost-effectiveLimited post-translational modifications, improper folding of membrane proteinsProtein domain studies, antibody production
ArabidopsisNative environment, physiological relevanceLower yield, longer generation timeIn planta functional studies, protein-protein interactions
Transient tobacco expressionRapid results, good for screeningVariability between experimentsInitial functional screening (as used in TSAL method )

How can I detect and measure ABCB24 expression in different plant tissues?

To effectively measure ABCB24 expression:

  • Transcript level analysis: RT-qPCR is the most reliable method, as demonstrated for ABCC4 . Design gene-specific primers spanning exon-exon junctions to avoid genomic DNA amplification. Include appropriate reference genes for normalization.

  • Protein level detection: Generate specific antibodies against ABCB24 or use epitope-tagged versions for Western blot analysis and immunolocalization studies.

  • Reporter gene fusions: Create ABCB24 promoter:GUS or ABCB24 promoter:GFP fusions to visualize tissue-specific expression patterns, similar to approaches used for other ABC transporters .

  • Response to stimuli: Examine expression changes under various conditions, as ABCC4 expression in roots was significantly upregulated in response to cytokinin treatment .

What experimental approaches can determine ABCB24 substrate specificity?

Determining substrate specificity for ABC transporters requires multiple complementary approaches:

  • Heterologous expression systems: Express ABCB24 in yeast strains deficient in endogenous transporters and perform transport assays with candidate substrates, similar to the approach used for ABCC4 with labeled cytokinins . Measure substrate accumulation using LC-MS/MS or other appropriate analytical methods.

  • TSAL method: Use the tobacco syringe agroinfiltration and liquid chromatography-mass spectrometry (TSAL) method that successfully identified ABCC4 as a cytokinin transporter . This method allows for transient expression followed by quantification of potential substrates in the cellular incubation buffer.

  • Genetic approaches: Analyze phenotypes of ABCB24 loss-of-function mutants and overexpression lines, particularly focusing on mitochondrial functions. Compare metabolite profiles between wildtype and mutant plants using metabolomics.

  • Competition assays: Test whether transport of confirmed substrates can be competitively inhibited by other candidate molecules, providing insights into binding site preferences.

Table 2: Potential Experimental Workflow for ABCB24 Substrate Identification

Experimental PhaseTechniquesExpected OutcomesConsiderations
Initial screeningTSAL method, yeast heterologous expressionCandidate substrate listFocus on compounds relevant to mitochondrial function
ValidationDirect transport assays with radiolabeled or stable isotope-labeled substratesConfirmation of primary substratesControl for membrane integrity and cell viability
In planta confirmationMetabolite profiling of knockout vs. wildtype, phenotypic analysisPhysiological relevance of transportConsider redundancy with other transporters
Structure-activity relationshipTesting structural analogs of confirmed substratesBinding site characteristicsUse computational modeling to support findings

How do post-translational modifications affect ABCB24 transport activity?

Post-translational modifications (PTMs) can significantly impact ABC transporter function:

  • Phosphorylation: Based on knowledge from other ABC transporters, phosphorylation may regulate ABCB24 activity. Identify potential phosphorylation sites using prediction algorithms and confirm with phosphoproteomic analysis. Create phosphomimetic (S/T→D/E) and phosphodeficient (S/T→A) mutants to assess functional consequences.

  • Ubiquitination: May control protein turnover and membrane localization. Use ubiquitination site prediction tools and immunoprecipitation with ubiquitin antibodies to identify modification sites.

  • Experimental approaches:

    • Mass spectrometry to identify PTMs

    • Site-directed mutagenesis to create PTM-deficient variants

    • In vitro kinase assays to identify kinases responsible for phosphorylation

    • Protein stability assays to determine how PTMs affect ABCB24 turnover

The regulation of ABCB24 may share similarities with other ABC transporters, such as how the expression of ABCC4 is regulated by cytokinins , suggesting potential signaling pathways that might also control ABCB24 through PTMs.

How can I investigate ABCB24 function in mitochondrial homeostasis?

To investigate ABCB24's role in mitochondrial function:

  • Mitochondrial isolation and transport studies:

    • Isolate intact mitochondria from wildtype and ABCB24 mutant plants

    • Measure substrate transport across the mitochondrial membrane

    • Compare ATP production and respiratory capacity

  • Metabolic profiling:

    • Conduct targeted metabolomics focusing on mitochondrial metabolites

    • Analyze changes in TCA cycle intermediates and related metabolites

    • Examine metabolic flux using stable isotope labeling approaches

  • Stress response analysis:

    • Evaluate how ABCB24 mutants respond to oxidative stress, similar to studies showing how loss of ABCC3 confers hypersensitivity to bleomycin

    • Examine mitochondrial morphology and dynamics under stress conditions

    • Test responses to mitochondrial inhibitors

Table 3: Assessment of Mitochondrial Function in ABCB24 Mutants

ParameterMethodologyExpected Differences in ABCB24 MutantsControls
Respiratory capacityOxygen consumption measurementsPotentially reduced respiration if substrate import is compromisedAlternative oxidase inhibitors to distinguish respiratory pathways
ROS productionFluorescent probes (DCF-DA, MitoSOX)Altered ROS levels depending on ABCB24 functionPositive controls with respiratory inhibitors
Membrane potentialFluorescent dyes (TMRM, JC-1)Changes in ΔΨm if ion homeostasis is affectedUncouplers as positive controls
ATP productionLuciferase-based ATP assaysPotentially reduced ATP synthesisComparison with known mitochondrial transporter mutants

What strategies can resolve contradictory findings about ABCB24 function?

When faced with conflicting data regarding ABCB24 function:

  • Standardize experimental conditions: Different growth conditions can significantly affect transporter expression and activity, as seen with ABCC4 whose expression in roots is regulated by cytokinins .

  • Consider genetic background effects: Use multiple alleles of ABCB24 mutants in different ecotypes to determine if background effects contribute to phenotypic variations.

  • Evaluate redundancy: Examine expression and function of closely related ABC transporters that might compensate for ABCB24 loss. Create higher-order mutants to address functional redundancy.

  • Tissue-specific analysis: Contradictory findings may result from tissue-specific functions. Use tissue-specific promoters to express ABCB24 in different cell types and assess phenotypic rescue.

  • Substrate concentration dependence: Similar to ABCB4, which shows concentration-dependent transport activity (uptake at low and efflux at high auxin concentrations) , ABCB24 might exhibit complex concentration-dependent transport behavior.

What are the key controls needed when studying ABCB24 in heterologous systems?

When expressing ABCB24 in heterologous systems:

  • Expression controls:

    • Empty vector controls to account for endogenous transport activities

    • Verification of protein expression through Western blotting

    • Subcellular localization confirmation using fluorescent protein fusions

  • Transport assay controls:

    • ATP-depleted samples to confirm ATP-dependence of transport

    • Known inhibitors of ABC transporters as negative controls

    • Temperature-sensitive controls (4°C vs. room temperature) to distinguish active transport from diffusion

  • Specificity controls:

    • Structurally related non-substrate compounds

    • Other ABC transporter family members as specificity comparisons

    • Mutated, non-functional ABCB24 (Walker A/B domain mutations)

Table 4: Troubleshooting Guide for Heterologous Expression of ABCB24

IssuePotential CausesSolutionsVerification Methods
Low expression levelsProtein toxicity, codon biasUse inducible promoters , codon optimizationWestern blot, fluorescent tagging
Improper localizationMissing targeting sequencesInclude mitochondrial targeting sequenceSubcellular fractionation, microscopy
No detectable transportIncorrect substrate, inactive proteinTry multiple potential substrates, verify ATP bindingSubstrate screening, ATPase assays
High backgroundEndogenous transportersUse transport-deficient strains, specific inhibitorsControl with vector-only samples

How can genetic screens be designed to identify components interacting with ABCB24?

To identify genes and proteins that interact with or regulate ABCB24:

  • Suppressor/enhancer screens:

    • Generate sensitized backgrounds (ABCB24 overexpression or partial loss-of-function)

    • Screen for mutations that suppress or enhance the phenotype

    • Map and identify the modifying genes

  • Yeast two-hybrid or split-ubiquitin screens:

    • Use different domains of ABCB24 as baits

    • Screen against Arabidopsis cDNA libraries

    • Validate interactions through co-immunoprecipitation and bimolecular fluorescence complementation

  • Proteomics approaches:

    • Immunoprecipitation of tagged ABCB24 followed by mass spectrometry

    • Comparative proteomics of mitochondria from wildtype vs. ABCB24 mutants

    • BioID or proximity labeling to identify proteins in close proximity to ABCB24

  • Transcriptomics:

    • RNA-seq analysis of ABCB24 mutants to identify affected pathways

    • Look for genes co-regulated with ABCB24 across different conditions and tissues

Similar genetic screening approaches have successfully identified components in other ABC transporter pathways, such as the finding that protein kinase ATM and transcription factor SOG1 regulate ABCC3 expression in DNA damage response .

What advanced imaging techniques can visualize ABCB24 transport activity in living cells?

To visualize ABCB24 transport in real-time:

  • Fluorescent substrate analogs:

    • Develop fluorescent derivatives of confirmed ABCB24 substrates

    • Track their movement into mitochondria using confocal microscopy

    • Compare transport kinetics between wildtype and mutant cells

  • FRET-based sensors:

    • Design sensors that detect substrate concentration changes

    • Express these sensors in the mitochondrial matrix or intermembrane space

    • Monitor real-time changes in substrate levels

  • Super-resolution microscopy:

    • Use techniques like STORM or PALM to visualize ABCB24 distribution within mitochondrial membranes

    • Track dynamic changes in response to cellular stimuli

  • Correlative light and electron microscopy (CLEM):

    • Combine fluorescence imaging with high-resolution ultrastructural analysis

    • Examine how ABCB24 localization relates to mitochondrial structure

These approaches would build upon visualization methods used for other plant ABC transporters, such as the localization studies conducted for ABCC4 in Arabidopsis tissues .

How might ABCB24 function in plant stress responses?

Based on findings with other ABC transporters:

  • Oxidative stress: ABCB24 might transport antioxidants or their precursors into mitochondria to mitigate ROS damage, similar to how ABCC3 contributes to bleomycin resistance .

  • Metabolic adjustments: During stress, ABCB24 could facilitate changes in mitochondrial metabolism by altering substrate availability.

  • Signaling molecules: ABCB24 might transport mitochondrial signaling molecules that communicate with the nucleus during retrograde signaling.

  • Experimental approaches:

    • Compare stress responses (drought, salt, temperature, pathogen) between wildtype and ABCB24 mutants

    • Analyze expression patterns of ABCB24 under various stresses

    • Examine mitochondrial function in stressed ABCB24 mutants

Stress-responsive expression analysis should be conducted similar to cytokinin response studies for ABCC4, which showed that expression in roots was significantly upregulated after cytokinin treatment .

What computational approaches can predict ABCB24 structure and substrate binding?

Modern computational tools offer powerful insights into transporter function:

  • Homology modeling:

    • Use resolved structures of related ABC transporters as templates

    • Model ABCB24 transmembrane domains and nucleotide-binding domains

    • Refine models using molecular dynamics simulations

  • Molecular docking:

    • Perform in silico docking of potential substrates to predicted binding sites

    • Calculate binding energies and identify key interacting residues

    • Validate computational predictions with site-directed mutagenesis

  • Machine learning approaches:

    • Train models using known ABC transporter-substrate pairs

    • Predict potential ABCB24 substrates based on physicochemical properties

    • Integrate transcriptomic and metabolomic data to identify correlations

  • Systems biology modeling:

    • Integrate ABCB24 function into metabolic models of plant mitochondria

    • Simulate effects of altered ABCB24 activity on mitochondrial metabolism

    • Identify potential regulatory interactions

These computational approaches complement experimental methods and can guide the design of targeted experiments to confirm ABCB24 substrate specificity.

What are the most promising research directions for ABCB24 in plant biology?

The study of ABCB24 intersects with several exciting research areas:

  • Mitochondrial-nuclear communication: Investigating how ABCB24 might participate in retrograde signaling pathways that coordinate nuclear gene expression with mitochondrial function.

  • Agricultural applications: Understanding how ABCB24 contributes to stress tolerance could inform breeding strategies for climate-resilient crops.

  • Evolutionary conservation: Comparative analysis of ABCB24 across plant species may reveal evolutionary adaptations in mitochondrial transport systems.

  • Integration with other transport systems: Exploring how ABCB24 works in concert with other transporters, similar to the complex network of transporters involved in cytokinin flow .

Research on ABCB24 will benefit from the methodological advances demonstrated in studies of other ABC transporters, such as the TSAL method used to identify ABCC4 as a cytokinin transporter , and the genetic approaches used to characterize ABCC3's role in bleomycin resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.