Recombinant Arabidopsis thaliana ABC transporter B family member 25, mitochondrial (ABCB25)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Characteristics

  • Gene Name: ABCB25 (synonyms: ATM3, STA1, AT5G58270) .

  • Protein Length: 631 amino acids (mature protein: residues 98–728) with a molecular weight of ~70 kDa .

  • Domains: Contains conserved ATP-binding domains and transmembrane helices typical of ABC transporters .

Expression Systems and Purification

ParameterSpecification
Host SystemsE. coli, yeast, baculovirus, mammalian cells
TagN-terminal His-tag for affinity purification
Purity≥85–90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Key Biological Functions

  • Fe-S Cluster Export: Mediates mitochondrial export of Fe-S clusters to cytosolic/nuclear enzymes .

  • Heavy Metal Detoxification: Confers resistance to Cd(II) and Pb(II) by regulating metal ion flux .

  • Moco Biosynthesis: Transports cyclic pyranopterin monophosphate (cPMP), a Moco precursor, from mitochondria to the cytosol .

  • Glutathione Polysulfide Transport: Facilitates glutathione trisulfide (GS-S-SG) export, critical for cytosolic Fe-S protein maturation .

Phenotypic Impacts of ABCB25 Mutants

PhenotypeDescription
DwarfismReduced plant height and chlorotic leaves
Root/Silique TwistingHelical growth due to disrupted auxin transport
Moco Deficiency50% reduction in nitrate reductase and sulfite oxidase activity

Subcellular Localization and Mechanism

  • Mitochondrial Matrix Localization: CNX2 and CNX3 enzymes (involved in cPMP synthesis) are mitochondrial, requiring ABCB25 for cPMP export .

  • Transport Specificity:

    • Substrates: Glutathione disulfide (GSSG) and trisulfide (GS-S-SG) .

    • ATPase Activity: Stimulated 3-fold by GSSG, but not by Fe²⁺ or reduced glutathione .

Comparative Analysis of ABCB Transporters

TransporterFunctionInteraction with ABCB25
ABCB1/19Auxin transportPartial functional overlap
ABCB6/20Organ twisting phenotypesCompensates for ABCB25 loss

Protein Expression and Quality Control

  • Amino Acid Sequence: Includes conserved motifs for ATP-binding (e.g., Walker A/B) and transmembrane domains .

  • Reconstitution: Optimal solubility achieved in deionized water with 5–50% glycerol .

  • Applications:

    • ELISA and Western blotting for protein interaction studies .

    • Functional assays for Fe-S cluster/Moco biosynthesis .

Evolutionary and Ecological Context

  • Conservation: Orthologs in Saccharomyces cerevisiae (Atm1) and humans (ABCB7) share Fe-S cluster export roles .

  • Ecotypic Variation: No significant phenotypic compensation by ABCB1 or ABCB2 in Arabidopsis mutants, highlighting ABCB25’s unique role .

Challenges and Future Directions

  • Substrate Competition: ABCB11/14 exhibit auxin transport activity but are outcompeted by other substrates in planta .

  • Biochemical Bottlenecks: Mitochondrial cPMP accumulation in abcb25 mutants suggests incomplete understanding of export regulation .

Recombinant ABCB25 remains indispensable for dissecting mitochondrial transport mechanisms, with implications for bioengineering stress-tolerant crops. Its dual role in Fe-S/Moco metabolism positions it as a nexus for studying plant redox homeostasis.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize the development of your specified tag.
Synonyms
ABCB25; ATM3; STA1; At5g58270; MCK7.14; ABC transporter B family member 25, mitochondrial; ABC transporter ABCB.25; AtABCB25; ABC transporter of the mitochondrion 3; AtATM3; Iron-sulfur clusters transporter ATM3; Protein STARIK 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
98-728
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ABCB25
Target Protein Sequence
DQTTTKTKEIKTTSSDSDSAMADMKILRTLAGYLWMRDNPEFRFRVIAALGFLVGAKVLN VQVPFLFKLAVDWLASATGTGASLTTFAATNPTLLTVFATPAAVLIGYGIARTGSSAFNE LRTAVFSKVALRTIRSVSRKVFSHLHDLDLRYHLSRETGGLNRIIDRGSRAINFILSAMV FNVVPTILEISMVSGILAYKFGAAFAWITSLSVGSYIVFTLAVTQWRTKFRKAMNKADND ASTRAIDSLINYETVKYFNNEGYEAEKYDQFLKKYEDAALQTQRSLAFLNFGQSIIFSTA LSTAMVLCSQGIMNGQMTVGDLVMVNGLLFQLSLPLNFLGSVYRETIQSLVDMKSMFQLL EEKSDITNTSDAKPLVLKGGNIEFENVHFSYLPERKILDGISFVVPAGKSVAIVGTSGSG KSTILRMLFRFFDTDSGNIRIDGQDIKEVRLDSLRSSIGVVPQDTVLFNDTIFHNIHYGR LSATEEEVYEAARRAAIHETISNFPDKYSTIVGERGLKLSGGEKQRVALARTFLKSPAIL LCDEATSALDSTTEAEILNALKALASNRTSIFIAHRLTTAMQCDEIVVLENGKVVEQGPH DELLGKSGRYAQLWTQQNSSVDMLDAAIKLE
Uniprot No.

Target Background

Function
This protein plays a crucial role in the production of cytoplasmic iron-sulfur proteins by facilitating the export of Fe/S cluster precursors synthesized by NFS1 and other mitochondrial proteins. It is not essential for mitochondrial and plastid Fe-S enzymes. This protein likely participates in the export of cyclic pyranopterin monophosphate (cPMP) from mitochondria to the cytosol. It mediates glutathione-dependent resistance to heavy metals such as cadmium and lead, and contributes to their transport from roots to leaves. It regulates nonprotein thiols (NPSH) and the cellular level of glutathione (GSH).
Gene References Into Functions
  1. The growth phenotype of atm3-1 was significantly enhanced by depletion of the mitochondrion-localized, GSH-dependent persulfide oxygenase ETHE1, suggesting that the physiological substrate of ATM3 contains persulfide in addition to glutathione PMID: 25006243
  2. AtATM3 contributes to heavy metal resistance and may mediate the transport of glutamine synthetase-conjugated Cd(II) across the mitochondrial membrane in Arabidopsis. PMID: 16461380
  3. Research indicates that STABILIZED1 (STA1) is a pre-mRNA splicing factor essential not only for splicing but also for the turnover of unstable transcripts, playing a significant role in plant responses to abiotic stresses. PMID: 16751345
  4. Arabidopsis ATM3 may transport (1) at least two distinct compounds or (2) a single compound required for both Fe-S and molybdenum cofactor assembly machineries in the cytosol, but not iron. PMID: 19710232
Database Links

KEGG: ath:AT5G58270

STRING: 3702.AT5G58270.1

UniGene: At.21228

Protein Families
ABC transporter superfamily, ABCB family, Heavy Metal importer (TC 3.A.1.210) subfamily
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed at high levels in roots, leaves, stems, flowers and siliques.

Q&A

What is the basic structure of ABCB25/ATM3 and how does it compare to other ABC transporters?

ABCB25/ATM3 belongs to the B subfamily of ATP-binding cassette (ABC) transporters. Like other ABC transporters, it contains two main structural domains: transmembrane domains (TMDs) and nucleotide-binding domains (NBDs). The protein is organized as a "half-transporter" with one TMD and one NBD that must dimerize to become functional. Unlike some ABC transporters that exist as full transporters with two TMDs and two NBDs encoded in a single polypeptide, ABCB25 follows the common mitochondrial ABC transporter architecture .

The functional structure requires ATP binding and hydrolysis at the NBDs to power the transport mechanism. Sequence alignments with other ABC transporters show the presence of highly conserved Walker A and B motifs in the NBDs, which are critical for ATP binding and hydrolysis .

What physiological roles does ABCB25/ATM3 play in Arabidopsis thaliana?

ABCB25/ATM3 plays several critical roles in plant physiology:

  • Iron-sulfur cluster assembly: It exports glutathione polysulfides from mitochondria to the cytosol for cytosolic iron-sulfur cluster assembly .

  • Molybdenum cofactor biosynthesis: It contributes to the biosynthesis of molybdenum cofactor, which is essential for the activity of several enzymes involved in nitrogen metabolism and hormone biosynthesis .

  • Redox homeostasis: By transporting glutathione derivatives, it contributes to cellular redox balance .

  • Heavy metal resistance: Some studies suggest it may be involved in heavy metal detoxification pathways.

These functions make ABCB25/ATM3 essential for normal plant growth and development, particularly under stress conditions that affect iron homeostasis or increase oxidative stress.

What are the most effective methods for expressing and purifying recombinant ABCB25/ATM3 for biochemical studies?

Expression and purification of functional ABCB25/ATM3 requires specialized approaches due to its membrane-embedded nature:

Expression Systems:

  • Insect cells (High-Five or Sf9): Often preferred for eukaryotic membrane proteins, allowing proper folding and post-translational modifications.

  • Bacterial systems (E. coli): Can be used with specialized strains (C41, C43) designed for membrane protein expression.

  • Yeast systems (S. cerevisiae, P. pastoris): Provide eukaryotic expression environment with easier handling than insect cells.

Purification Protocol:

  • Membrane preparation: Isolate membranes by differential centrifugation

  • Solubilization: Use mild detergents (DDM, LMNG, or UDM at 1-2%) that maintain protein activity

  • Affinity purification: Using His, FLAG or other affinity tags

  • Size exclusion chromatography: For final polishing and buffer exchange

Critical factors for success:

  • Include ATP analogs or nucleotides during purification to stabilize the NBD

  • Maintain physiological pH (7.2-7.5)

  • Include glycerol (10-20%) to improve stability

  • Consider nanodiscs or amphipols for detergent-free environments if activity issues arise

The purity can be assessed by SDS-PAGE and Western blotting using antibodies against ABCB25 or the affinity tag, while functionality can be verified through ATPase activity assays .

How can researchers effectively measure ABCB25/ATM3 transport activity in vitro?

Several complementary approaches can be used to measure ABCB25/ATM3 transport activity:

Reconstituted Proteoliposome Assays:

  • Reconstitute purified ABCB25 into artificial liposomes

  • Create an ATP-containing environment inside or outside the vesicles

  • Measure substrate transport using radiolabeled substrates (³⁵S-GSH or derivatives)

  • Quantify substrate accumulation inside vesicles over time

2. LC-MS Metabolomic Approach:
This approach has been particularly successful for ABCB25/ATM3:

  • Generate proteoliposomes with entrapped transporter

  • Incubate with potential substrates and ATP

  • Extract contents and analyze by LC-MS

  • Compare substrate levels with control vesicles (without ATP or with inactive transporter)

This metabolomic approach successfully identified glutathione polysulfides as physiological substrates for ABCB25/ATM3 .

ATPase Activity Coupled Assays:

  • Measure ATP hydrolysis (which is coupled to transport) using:

    • NADH-coupled enzyme assay (continuous monitoring)

    • Malachite green phosphate detection (endpoint)

    • Luminescence-based ATP detection

Data Analysis Considerations:

  • Subtract background (no ATP or inactive protein control)

  • Account for passive diffusion

  • Calculate initial rates from linear portion of transport curve

  • Use Michaelis-Menten kinetics to determine Km and Vmax values

For valid results, ensure the protein is correctly oriented in the membrane, as ABC transporters are directional transporters .

What phenotypes are associated with ABCB25/ATM3 mutants in Arabidopsis thaliana, and how are they characterized?

ABCB25/ATM3 mutants display several characteristic phenotypes that can be measured using standardized approaches:

Biochemical Phenotypes:

  • Decreased cytosolic iron-sulfur enzyme activities:

    • Aconitase activity (spectrophotometric assay)

    • Aldehyde oxidase (in-gel activity assay)

    • Xanthine dehydrogenase (in-gel activity assay)

  • Altered iron distribution (Perls' staining)

  • Accumulation of glutathione in mitochondria (confocal microscopy with GSH-sensitive fluorescent dyes)

Stress Response Phenotypes:

  • Hypersensitivity to heavy metals (survival rate on media with cadmium/lead)

  • Altered response to oxidative stress (H₂O₂ treatment survival)

Molecular Phenotypes:

  • Changes in gene expression of iron homeostasis genes (RT-qPCR)

  • Alterations in mitochondrial redox state (redox-sensitive GFP reporters)

The severity of these phenotypes often correlates with the level of ABCB25 disruption, with complete knockouts showing the most severe effects. Complementation experiments using wild-type ABCB25 should be performed to confirm that observed phenotypes are specifically due to ABCB25 loss .

How can researchers distinguish between direct and indirect effects when studying ABCB25/ATM3 function?

Distinguishing direct from indirect effects is a common challenge in ABC transporter research. For ABCB25/ATM3, use these approaches:

Direct Substrate Verification Methods:

  • Direct binding assays with purified protein and potential substrates

  • Transport assays in reconstituted systems (as described in 2.2)

  • Competition assays with known substrates

  • Structure-activity relationship studies with substrate analogs

Genetic Approaches:

  • Inducible knockdown/knockout systems to observe immediate vs. delayed effects

  • Site-directed mutagenesis of key residues:

    • Walker A/B motifs (ATP binding/hydrolysis)

    • Substrate-binding pocket mutations

    • Transmembrane domain mutations

Rescue Experiments:

  • Complementation with wild-type ABCB25

  • Complementation with ABCB25 containing specific mutations

  • Heterologous expression of ABCB25 orthologs from other species

Temporal Analysis:

  • Time-course experiments after conditional inactivation

  • Metabolite profiling at different time points

  • Transcriptomics/proteomics at various intervals after disruption

Multi-omics Integration:

  • Combine metabolomics, transcriptomics, and proteomics data

  • Use network analysis to distinguish primary from secondary effects

  • Apply mathematical modeling to predict direct vs. cascade effects

Data Interpretation Example:
The identification of glutathione polysulfides as ABCB25/ATM3 substrates demonstrates an effective approach - using LC-MS metabolomics identified candidate substrates, which were then confirmed through direct transport assays and followed by genetic validation experiments to verify physiological relevance .

What techniques are most effective for studying ABCB25/ATM3 dimerization and its impact on transport function?

ABCB25/ATM3, like other ABC half-transporters, must dimerize to form a functional transporter. Several complementary approaches can be used to study this process:

Biochemical Approaches:

  • Cross-linking studies: Using chemical cross-linkers followed by SDS-PAGE and mass spectrometry

  • Co-immunoprecipitation: With differently tagged versions of ABCB25

  • Blue native PAGE: To observe native dimeric complexes

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS): For determining the absolute molecular weight of complexes

Biophysical Methods:

  • Förster resonance energy transfer (FRET): Using fluorescently tagged ABCB25 variants

  • Bioluminescence resonance energy transfer (BRET): Similar to the NanoBRET approach used for ABCB5 heterodimers

  • Single-molecule techniques: To observe dimerization dynamics

  • Analytical ultracentrifugation: To determine oligomeric state

Structural Approaches:

  • Cryogenic electron microscopy (cryo-EM): For visualization of dimeric structures

  • X-ray crystallography: If crystals can be obtained

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To identify interaction interfaces

Functional Assays:

  • Complementation with inactive mutants: Testing dominant-negative effects

  • Split-protein complementation assays: Using split-GFP or split-luciferase fusions

  • Heterodimeric constructs: Creating artificial dimers with the P-gp linker (as done for ABCB5/6/9 studies)

Data Analysis Considerations:

  • Compare dimerization efficiency under different conditions (ATP presence, substrate presence)

  • Correlate dimerization status with transport activity

  • Identify residues at the dimer interface through mutagenesis

Based on studies of related transporters, ATP binding likely stabilizes the NBD dimer interface while influencing conformational changes in the TMDs .

How does ABCB25/ATM3 compare to homologous transporters in other organisms, and what insights can be gained from these comparisons?

Comparative analysis of ABCB25/ATM3 with homologs across species provides valuable insights into conservation and specialization:

Evolutionary Conservation Analysis:

OrganismHomologIdentity (%)Key Functional Differences
HumanABCB7~40-45Associated with X-linked sideroblastic anemia and ataxia
MouseAbcb7~42Similar function, but mouse knockout is embryonic lethal
YeastAtm1p~45First characterized mitochondrial ABC transporter
RiceOsATM3~70Similar function but different stress responses
BacteriaCydDC~30 (NBD)Exports cysteine and glutathione; role in redox sensing

Comparative Structure-Function Studies:

  • The human ABCB7 transporter has been more extensively characterized in disease contexts

  • Yeast Atm1p has been crystallized, providing structural templates for homology modeling

  • Bacterial CydDC offers insights into the evolution of redox-related transport functions

Research Approaches for Comparative Studies:

  • Complementation experiments: Can human ABCB7 rescue Arabidopsis abcb25 mutants?

  • Domain swapping: Exchange domains between homologs to identify functional specificity

  • Conserved residue analysis: Identify residues conserved across all homologs vs. plant-specific ones

  • Differential substrate specificity: Compare transport profiles across species

  • Cross-species phenotype analysis: Compare physiological roles in different organisms

Key Insights from Comparative Studies:

  • The core mechanism of glutathione polysulfide transport appears conserved from yeast to plants and humans

  • Plant-specific adaptations may relate to specialized metal homeostasis needs

  • Understanding human ABCB7 dysfunction in disease provides insights into fundamental mechanisms

This comparative approach has been particularly valuable in identifying conserved functional residues and species-specific adaptations .

What are the current methodologies for investigating the structural dynamics of ABCB25/ATM3 during the transport cycle?

Understanding the conformational changes that occur during the transport cycle is crucial for elucidating ABCB25/ATM3 mechanism. Several advanced techniques can be applied:

EPR Spectroscopy Approaches:

  • Site-directed spin labeling (SDSL): Introduce spin labels at specific residues

  • Double electron-electron resonance (DEER): Measure distances between spin labels

  • Continuous wave EPR: Probe local environment and accessibility

  • This approach has been successfully applied to P-gp and MsbA transporters to track conformational changes during transport cycles

Fluorescence-Based Methods:

  • Site-specific fluorescent labeling: Using cysteine-reactive fluorescent probes

  • Single-molecule FRET: Track distance changes between domains in real-time

  • Fluorescence quenching: Probe accessibility changes during transport

Structural Methods with Time Resolution:

  • Time-resolved cryo-EM: Capture different conformational states

  • X-ray radiolytic footprinting combined with mass spectrometry (XF-MS): Identify solvent-accessible regions during transport

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Map dynamics of protein regions

Computational Methods:

  • Molecular dynamics simulations: Model conformational changes at atomic resolution

  • Targeted molecular dynamics: Simulate transitions between known conformational states

  • Normal mode analysis: Identify intrinsic dynamics relevant to function

Biochemical Approaches:

  • Disulfide cross-linking: Lock the transporter in specific conformations

  • Limited proteolysis: Identify flexible regions that change during transport

  • ATP hydrolysis assays with conformation-specific inhibitors

Experimental Design Considerations:

  • Compare apo, ATP-bound, and substrate-bound states

  • Use ATP analogs to trap specific catalytic intermediates

  • Combine multiple approaches for validation

The conformational dynamics of ABCB transporters typically involve alternating access of the substrate binding site between the inner and outer sides of the membrane, coupled to ATP binding and hydrolysis events.

What are the most effective strategies for generating and screening ABCB25/ATM3 variants with altered function?

Creating and screening ABCB25/ATM3 variants requires systematic approaches to modify the gene and evaluate resulting phenotypes:

Generation of Variants:

  • Site-Directed Mutagenesis Approaches:

    • Alanine-scanning mutagenesis of transmembrane regions

    • Targeted modification of Walker A/B motifs and other conserved sequences

    • Chimeric proteins with domains from homologous transporters

  • Random Mutagenesis Methods:

    • Error-prone PCR

    • DNA shuffling

    • CRISPR-based saturation mutagenesis

  • Structure-Guided Design:

    • Homology modeling based on related ABC transporter structures

    • In silico prediction of critical residues

    • Targeted modification of substrate binding pocket

Screening Strategies:

  • In Vivo Functional Complementation:

    • Transform ABCB25 mutants with variant libraries

    • Screen for restoration of growth under selective conditions

    • Quantify phenotypic rescue (root length, chlorophyll content)

  • Yeast-Based Transport Assays:

    • Express variants in Saccharomyces cerevisiae

    • Screen for altered substrate transport using fluorescent substrates

    • Monitor growth under conditions requiring transporter function

  • Biochemical Screening:

    • Express variants in heterologous systems

    • Isolate membrane fractions

    • High-throughput ATPase activity assays

Data Analysis Framework:

ParameterMethodExpected Outcome for Functional Variant
Growth complementationRoot length/fresh weight>80% of wild-type
Cytosolic Fe-S enzyme activitiesAconitase/aldehyde oxidase assays>75% of wild-type
Substrate transportReconstituted transport assaysDetectable transport above background
ATPase activityEnzymatic coupling assaysSubstrate-stimulated ATP hydrolysis
Protein expressionWestern blotComparable to wild-type

Validation of Hits:

  • Secondary screens with alternative substrates

  • Detailed biochemical characterization

  • In vivo phenotypic analysis in transgenic plants

This approach allows for systematic exploration of structure-function relationships and potential engineering of transporters with novel properties .

How can gene editing techniques like CRISPR-Cas9 be optimized for modifying ABCB25/ATM3 in Arabidopsis?

CRISPR-Cas9 offers powerful opportunities for precise genetic modification of ABCB25/ATM3 in Arabidopsis. Here's an optimized protocol:

Guide RNA Design and Optimization:

  • Target Selection Criteria:

    • Choose targets in coding regions, preferably early exons

    • Verify target uniqueness using BLAST against the Arabidopsis genome

    • Select targets with minimal predicted off-target sites

    • Avoid regions with high GC content

  • gRNA Design Tools:

    • CRISPR-P 2.0 or CRISPOR for plant-specific guide design

    • Calculate on-target efficiency scores (>0.6 preferred)

    • Ensure PAM site accessibility (NGG for SpCas9)

  • Multi-guide Strategy:

    • Design 3-4 guides targeting different exons

    • Test guides individually and in combination

Delivery and Transformation Methods:

  • Vector System Options:

    • Binary vectors for Agrobacterium-mediated transformation

    • All-in-one vectors containing Cas9 and gRNA expression cassettes

    • Egg cell-specific promoters (EC1.2) for germline editing

  • Transformation Protocol:

    • Floral dip transformation using Agrobacterium tumefaciens

    • Selection on appropriate antibiotics

    • PCR screening of T1 plants for transformants

Screening and Validation:

  • Mutation Detection:

    • T7 Endonuclease I assay for initial screening

    • PCR amplification and Sanger sequencing of target region

    • TIDE (Tracking of Indels by Decomposition) analysis for mixed chromatograms

  • Genotyping Strategy:

    GenerationScreening ApproachExpected Outcome
    T1Targeted sequencingChimeric edits
    T2PCR + sequencingHeterozygous/homozygous edits
    T3Confirmation and phenotypingStable homozygous lines
  • Off-Target Analysis:

    • Sequencing of predicted off-target sites

    • Whole-genome sequencing for comprehensive assessment

Advanced Modifications:

  • Precise Edits:

    • Homology-directed repair with donor templates

    • Base editing for specific nucleotide changes

    • Prime editing for precise insertions/deletions

  • Domain-Specific Modifications:

    • Targeted modification of ATP-binding sites

    • Alteration of substrate-binding residues

    • Creation of reporter fusions

By following this protocol, researchers can generate precise modifications to study specific aspects of ABCB25/ATM3 function in its native genomic context .

How can researchers accurately determine the substrate specificity of ABCB25/ATM3?

Determining the substrate specificity of ABCB25/ATM3 requires a multi-faceted approach:

Metabolomic Screening Approach:

  • Generate proteoliposomes containing purified ABCB25/ATM3

  • Prepare mitochondrial extracts from wild-type and ABCB25-deficient plants

  • Perform untargeted LC-MS metabolomics comparing the profiles

  • Identify metabolites that accumulate in ABCB25-deficient mitochondria

  • Validate candidates through direct transport assays

This approach successfully identified glutathione polysulfides as physiological substrates for ABCB25/ATM3 .

Direct Transport Assays:

  • Reconstitute ABCB25/ATM3 into liposomes

  • Test candidate substrates using:

    • Radiolabeled substrates ([³⁵S]-GSH, [³⁵S]-GSSG)

    • Fluorescently labeled substrates

    • LC-MS detection of non-labeled substrates

  • Compare transport rates with and without ATP

  • Include competition experiments with known substrates

Binding Studies:

  • Substrate-induced changes in ATPase activity

  • Thermal shift assays to detect substrate binding

  • Microscale thermophoresis (MST) to measure binding affinities

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

Structure-Activity Relationship Analysis:

  • Test a series of structurally related compounds

  • Determine minimal structural requirements for transport

  • Create a pharmacophore model of substrate recognition

Genetic Approaches:

  • Mutate residues predicted to be involved in substrate binding

  • Compare substrate profiles between orthologs from different species

  • Generate chimeric transporters with altered specificity

Data Analysis Framework:

ParameterMethodInterpretation
Transport rateInitial velocity in proteoliposomesDirect measure of transport capability
Apparent KmConcentration-dependent transportAffinity for substrate
Competitive inhibitionTransport in presence of competitorsShared binding site
ATPase stimulationATP hydrolysis rateFunctional coupling to transport

This comprehensive approach provides multiple lines of evidence for substrate specificity and can distinguish between actual substrates and molecules that may bind but are not transported .

What are the best experimental designs for studying ABCB25/ATM3 function under different stress conditions?

To effectively study ABCB25/ATM3 function under stress conditions, carefully designed experiments are essential:

Stress Treatment Design Principles:

  • Dose-Response Relationships:

    • Apply stress treatments at multiple intensities

    • Determine EC₅₀ values for wild-type vs. mutant plants

    • Example stressors: heavy metals (Cd²⁺, Pb²⁺), oxidative agents (H₂O₂, paraquat)

  • Time-Course Experiments:

    • Monitor responses from minutes to days

    • Capture both immediate and adaptive responses

    • Sample at logarithmic time intervals (e.g., 0.5, 1, 3, 8, 24, 72 hours)

  • Combinatorial Stress Treatments:

    • Apply factorial designs with multiple stressors

    • Analyze potential synergistic or antagonistic effects

    • Include recovery phases after stress exposure

Experimental Designs for Specific Stressors:

Stress TypeTreatment MethodResponse Measurements
Heavy MetalsGrowth on media with defined metal concentrationsRoot growth, metal accumulation, chlorosis
Oxidative StressH₂O₂, paraquat, or menadione exposureROS levels, lipid peroxidation, antioxidant enzyme activities
Iron StarvationGrowth on iron-depleted mediaChlorophyll content, iron-dependent enzyme activities
Iron ExcessGrowth on high-iron mediaIron accumulation, oxidative damage markers

Advanced Experimental Design Approaches:

  • Factorial Designs:

    • Implement 2ᵏ factorial designs where k = number of factors

    • Analyze main effects and interactions between factors

    • Use ANOVA for statistical analysis

  • Split-Plot Designs:

    • For experiments with both whole-plot factors (e.g., genotype) and split-plot factors (e.g., time points)

    • Appropriate for repeated measures over time

  • Response Surface Methodology:

    • For optimization experiments with multiple continuous factors

    • Determine optimal conditions for ABCB25/ATM3 function

Data Collection and Analysis Framework:

  • Physiological Parameters:

    • Growth parameters (root length, biomass)

    • Photosynthetic efficiency (Fv/Fm)

    • Visual symptoms (chlorosis, necrosis)

  • Biochemical Parameters:

    • ABCB25/ATM3 expression levels (qRT-PCR, Western blot)

    • Transport activity in isolated mitochondria

    • Cytosolic and mitochondrial redox states

  • Molecular Parameters:

    • Transcriptome analysis (RNA-seq)

    • Metabolite profiling (targeted and untargeted)

    • Post-translational modifications of ABCB25/ATM3

Statistical Analysis:

  • Use appropriate transformations for non-normal data

  • Apply mixed-effects models for complex designs

  • Include multiple comparison corrections for large datasets

This comprehensive approach captures the dynamic role of ABCB25/ATM3 under various stress conditions and helps identify conditions where its function is particularly critical .

What techniques are most effective for identifying proteins that interact with ABCB25/ATM3?

Identifying protein interactors of ABCB25/ATM3 requires combining multiple complementary approaches:

Affinity Purification-Based Methods:

  • Immunoprecipitation (IP): Using antibodies against endogenous ABCB25

  • Tandem Affinity Purification (TAP): Using tagged ABCB25 expressed at near-endogenous levels

  • Co-immunoprecipitation (Co-IP): Pulling down ABCB25 and identifying co-purifying proteins

  • Proximity-dependent biotin identification (BioID): Fusing ABCB25 to a biotin ligase to label nearby proteins

Reconstitution-Based Methods:

  • Split-protein complementation: Using BiFC or split-luciferase assays

  • FRET/BRET: To detect direct protein-protein interactions

  • Yeast two-hybrid: For interactions involving soluble domains

  • Membrane yeast two-hybrid (MYTH): Specifically designed for membrane proteins

Crosslinking-Based Approaches:

  • Chemical crosslinking coupled to MS (XL-MS): To capture transient interactions

  • Photo-activatable crosslinking: Using genetically encoded crosslinkers

  • Proximity ligation assay (PLA): For detecting interactions in situ

Biophysical Methods:

  • Surface plasmon resonance (SPR): For quantitative binding parameters

  • Isothermal titration calorimetry (ITC): For thermodynamic characterization

  • Analytical ultracentrifugation: For complex formation analysis

Genetic Screens:

  • Suppressor screens: To identify genes that rescue ABCB25 mutant phenotypes

  • Synthetic genetic arrays: To identify genetic interactions

  • CRISPR screens: For systematic interaction mapping

Data Analysis Framework:

TechniqueStrengthsLimitationsData Analysis Approach
Affinity-MSComprehensive, unbiasedDetergent compatibility issuesSAINT or CompPASS algorithms
BiFC/FRETIn vivo confirmationPotential artifactsQuantitative fluorescence analysis
XL-MSSpatial constraintsComplex data analysisSpecialized crosslink search engines
Genetic screensFunctional relevanceIndirect interactionsNetwork analysis

Validation Strategy:

  • Confirm interactions by at least two independent methods

  • Demonstrate specificity with negative controls

  • Map interaction domains through truncation/mutation analysis

  • Assess functional relevance through phenotypic analysis

These approaches have been successfully applied to identify interacting partners of other ABC transporters, including factors involved in dimerization, regulation, and substrate handling .

How can researchers investigate post-translational regulation of ABCB25/ATM3?

Post-translational regulation can significantly impact ABCB25/ATM3 function. Here's a comprehensive methodology for its investigation:

Identification of Post-Translational Modifications (PTMs):

  • Mass Spectrometry-Based Approaches:

    • Enrichment strategies for specific PTMs (TiO₂ for phosphorylation, etc.)

    • Top-down proteomics for intact protein analysis

    • Heavy isotope labeling for quantitative comparison

  • Site-Specific Detection:

    • Phospho-specific antibodies (if available)

    • Chemical labeling of specific modifications

    • Phos-tag gels for mobility shift detection of phosphorylated proteins

Functional Impact Assessment:

  • Site-Directed Mutagenesis:

    • Phosphomimetic mutations (S/T to D/E)

    • Phospho-null mutations (S/T to A)

    • Other modification-specific mutations

  • Activity Assays:

    • Transport activity in proteoliposomes

    • ATPase activity measurements

    • Subcellular localization analysis

Regulation of PTMs:

  • Kinase/Phosphatase Identification:

    • Kinase inhibitor screens

    • In vitro kinase/phosphatase assays

    • Co-IP with candidate regulatory enzymes

  • Stimulus-Dependent Regulation:

    • Time-course analysis after specific treatments

    • Quantitative PTM analysis under stress conditions

    • Correlation with transporter activity

Methods for Specific PTMs:

ModificationDetection MethodFunctional Analysis
PhosphorylationMS/MS with neutral loss, Phos-tag gelsSite-directed mutagenesis, in vitro kinase assays
UbiquitinationUbiquitin remnant profiling, Western blotProteasome inhibitors, mutation of lysine residues
S-glutathionylationBiotinylated GSH labeling, MSRedox manipulation, cysteine mutagenesis
AcetylationAcetyl-lysine antibodies, MSHDAC inhibitors, lysine mutagenesis

Systems-Level Analysis:

  • PTM Crosstalk Analysis:

    • Multi-modification detection

    • Sequential modification studies

    • Interference analysis between modifications

  • Computational Approaches:

    • PTM site prediction algorithms

    • Structural modeling of modification impacts

    • Systems biology of PTM networks

Like CFTR and plant ABCB transporters, ABCB25/ATM3 likely undergoes phosphorylation that affects its activity or localization. The regulatory domain of CFTR provides a useful model for understanding how phosphorylation might regulate ABC transporter function.

What are the most suitable approaches for structural studies of ABCB25/ATM3?

Structural characterization of membrane proteins like ABCB25/ATM3 presents unique challenges. Here's a comprehensive strategy:

Protein Production Optimization:

  • Expression Systems Comparison:

    • Insect cells (High-Five, Sf9)

    • Yeast (P. pastoris, S. cerevisiae)

    • Bacterial systems with specialized strains

  • Construct Optimization:

    • Test orthologues from different species

    • Terminal and internal tags screening

    • Systematic truncation analysis

    • Thermostability-enhancing mutations

  • Purification Refinement:

    • Detergent screening (DDM, LMNG, UDM, etc.)

    • Membrane mimetics (nanodiscs, amphipols, SMALPs)

    • Lipid supplementation during purification

    • Addition of stabilizing ligands

Structural Methods Comparison:

MethodResolution RangeSample RequirementsAdvantagesLimitations
X-ray Crystallography1.5-3.5ÅDiffracting crystalsAtomic resolutionCrystallization challenges
Cryo-EM2.5-4.5ÅHomogeneous preparationNo crystals neededSize limitations
NMRN/A (chemical shifts)Isotope-labeled proteinDynamic informationSize limitations
SAXS10-30Å (envelope)Monodisperse solutionLow sample requirementsLow resolution
EPRN/A (distance constraints)Spin-labeled proteinConformational dynamicsSparse constraints

Complementary Approaches:

  • Hydrogen-Deuterium Exchange MS:

    • Maps solvent accessibility

    • Identifies flexible regions

    • Tracks conformational changes

  • Crosslinking Mass Spectrometry:

    • Provides distance constraints

    • Maps interaction interfaces

    • Compatible with various conditions

  • Computational Methods:

    • Homology modeling based on ABCB7, Atm1, or other ABC structures

    • Molecular dynamics simulations

    • AlphaFold2 prediction with experimental validation

Conformational State Capture:

  • Biochemical Trapping:

    • ATP analogs (AMP-PNP, ATP-γ-S)

    • Vanadate trapping

    • Substrate analogs

    • Conformation-specific nanobodies

  • Time-Resolved Methods:

    • Time-resolved cryo-EM

    • Rapid mixing with crosslinking

    • Temperature-jump with spectroscopic detection

Functional Validation:

  • Structure-Guided Mutagenesis:

    • Test predictions from structures

    • Identify critical residues

    • Validate proposed mechanisms

  • MDR Resistance Mutations:

    • Study mutations from related transporters

    • Map onto ABCB25 structure

    • Correlate with function

The most successful structural studies of ABC transporters have used combinations of these approaches, as exemplified by structural studies of ABCB10 and other mitochondrial ABC transporters.

How can systems biology approaches be applied to understand ABCB25/ATM3's role in cellular networks?

Systems biology offers powerful frameworks to understand ABCB25/ATM3's role within broader cellular networks:

Multi-omics Integration Approaches:

  • Data Collection Layers:

    • Transcriptomics (RNA-seq of wild-type vs. mutants)

    • Proteomics (quantitative proteomics, PTM analysis)

    • Metabolomics (targeted and untargeted approaches)

    • Ionomics (elemental profiling, particularly iron)

  • Integration Methods:

    • Multi-block data fusion algorithms

    • Network reconstruction approaches

    • Canonical correlation analysis

    • Machine learning for pattern recognition

Network Analysis Frameworks:

  • Protein-Protein Interaction Networks:

    • Place ABCB25/ATM3 in mitochondrial protein networks

    • Identify key interaction hubs connected to ABCB25/ATM3

    • Map genetic interactions onto protein networks

  • Metabolic Network Modeling:

    • Genome-scale metabolic models incorporating ABCB25/ATM3

    • Flux balance analysis with constraints from experimental data

    • Metabolic control analysis to quantify control coefficients

  • Signaling Networks:

    • Kinase-substrate networks related to ABCB25/ATM3 regulation

    • Signal transduction pathways affecting ABCB25/ATM3 function

    • Feedback loops involving ABCB25/ATM3 activity

Physiological Response Modeling:

  • Mathematical Modeling Approaches:

    • Ordinary differential equations (ODEs) for dynamics

    • Partial differential equations (PDEs) for spatial aspects

    • Stochastic models for low-copy number processes

  • Multi-scale Modeling:

    • Molecular scale (transport mechanism)

    • Cellular scale (compartment interactions)

    • Tissue/organism scale (physiological impacts)

Data Analysis and Visualization Frameworks:

Analysis ApproachApplicationsKey Outputs
Weighted Gene Correlation Network Analysis (WGCNA)Transcriptome dataCo-expression modules, hub genes
Metabolite Set Enrichment AnalysisMetabolomics dataPathway enrichment, metabolite clustering
Bayesian Network InferenceMulti-omics dataCausal relationship networks
Principal Component AnalysisAny high-dimensional dataDimension reduction, sample clustering

Validation Strategies:

  • Targeted Perturbation Experiments:

    • Validate predictions from network models

    • Test hypothesized regulatory relationships

    • Confirm proposed metabolic connections

  • Comparative Systems Analysis:

    • Compare network properties across species

    • Identify evolutionarily conserved modules

    • Relate to specialized physiological roles

These systems approaches have been particularly valuable in understanding ABC transporters' roles in complex phenotypes and identifying unexpected connections to seemingly unrelated cellular processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.