Recombinant Arabidopsis thaliana ABC transporter B family member 28 (ABCB28)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana ABC Transporter B Family Member 28 (ABCB28)

Recombinant Arabidopsis thaliana ABC transporter B family member 28 (ABCB28) is a protein involved in the transport of auxin, a key plant hormone, across cellular membranes. ABCB28 is part of the ATP-binding cassette (ABC) transporter family, which plays a crucial role in various cellular processes, including detoxification, nutrient uptake, and hormone transport. This protein is specifically localized to the inner envelope (IE) of chloroplasts in Arabidopsis thaliana, where it facilitates the efflux of auxin (indole-3-acetic acid, IAA) from chloroplasts into the cytosol .

Function and Localization of ABCB28

ABCB28 is primarily involved in the transport of auxin, which is essential for plant growth and development. Auxin plays a critical role in cell elongation, cell division, and differentiation, and its transport is crucial for maintaining proper auxin gradients within the plant. The localization of ABCB28 to the inner envelope of chloroplasts suggests that it may also be involved in stress responses, such as salt and drought stress, by modulating auxin levels within the chloroplast .

Research Findings on ABCB28

Recent studies have demonstrated that ABCB28 forms homodimers, which are essential for its function in auxin transport. The homodimerization of ABCB28 was confirmed through bimolecular fluorescence complementation (BiFC) assays and structural modeling based on high-resolution crystal structures of related transporters . Overexpression of ABCB28 enhances IAA export from chloroplasts, which can improve plant survival under stress conditions by reducing water loss and maintaining shoot growth .

Table 1: Key Features of ABCB28

FeatureDescription
LocalizationInner envelope (IE) of chloroplasts
FunctionAuxin (IAA) efflux from chloroplasts to cytosol
DimerizationForms homodimers
Role in StressImproves plant survival under salt and drought stress
ExpressionUpregulated during stress conditions

Implications of ABCB28 in Plant Stress Responses

The role of ABCB28 in stress responses is significant, as it helps plants adapt to adverse environmental conditions. By enhancing auxin efflux from chloroplasts, ABCB28 contributes to maintaining proper auxin signaling, which is crucial for stress adaptation. Plants overexpressing ABCB28 show improved survival rates under prolonged stress conditions, indicating its potential as a genetic tool for enhancing stress tolerance in crops .

Table 2: Effects of ABCB28 Overexpression on Plant Stress Tolerance

ParameterWild Type (WT)ABCB28 Overexpression
Survival RateBaselineIncreased (up to 66%)
Shoot GrowthAffected by stressMaintained under stress
Water Use Efficiency (WUE)BaselineImproved

References Chloroplast Auxin Efflux Mediated by ABCB28 and ABCB29 Fine-Tunes Water Use Efficiency Under Salt Stress. An ABC-transporter of Arabidopsis thaliana has both glutathione conjugate and chlorophyll catabolite transport activities. Meta-analysis and meta-regression of transcriptomic responses to water stress across studies. The role of ABC transporters in kin recognition in Arabidopsis thaliana. Recombinant Arabidopsis thaliana ABC transporter B family member 28 (ABCB28).

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
ABCB28; NAP8; At4g25450; M7J2.180; ABC transporter B family member 28; ABC transporter ABCB.28; AtABCB28; Non-intrinsic ABC protein 8; TAP-related protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-714
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ABCB28
Target Protein Sequence
MASATTLLFHHGSTRVLVARRRCQASVLRPYGGLKPFLSFCSLPNSTAPFRDSLRAKSDG LARAYVTGAPPIVEEPDPKIEESKSEAESKDLISWGLLWSLMSKHKLRLSVCLLTLLGCS TCTLSMPVFSGRFFEVLIGVRPEPLWRLLSKIAVLYSLEPIFTIAFVTNMTAIWENVMAI LRAQIFRRVLIQKAEFFDKYKVGELTGLLTSDLGALNSIVNDNISRDRGFRAFTEVFGTI CILFTLSPQLAPVLGLLMLAVSVLVAVYKRSTVPVYKSHGLAQATMSDCVSETFSAIRTV RSFSGEKRQMSIFGSQILAYKLSGLKLGTFKSINESITRVAVYISLLALYCLGGSKVKTG ELAVGTVVSFIGYTFTLTFAVQGLVNTFGDLRGTFAAIDRINSILNAVDIDEALAYGLER DIHTKKVQDENLKLFLSAGPNVNIRHLDKYYMSNLKSTNNLRTLTWAGDVCLDDVHFAYP LRPDVKVLDGLSLTLNSGTVTALVGSSGAGKSTIVQLLARFYEPTQGRITVGGEDVRMFD KSEWAKVVSIVNQEPVLFSLSVAENIAYGLPNEHVSKDDIIKAAKAANAHDFIISLPQGY DTLVGERGGLLSGGQRQRVAIARSLLKNAPILILDEATSALDAVSERLVQSALNRLMKDR TTLVIAHRLSTVQSANQIAVCSDGKIIELGTHSELVAQKGSYASLVGTQRLAFE
Uniprot No.

Target Background

Database Links

KEGG: ath:AT4G25450

STRING: 3702.AT4G25450.1

UniGene: At.32254

Protein Families
ABC transporter superfamily, ABCB family, Multidrug resistance exporter (TC 3.A.1.201) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Arabidopsis thaliana ABCB28?

ABCB28 is an ATP-binding cassette (ABC) transporter belonging to subfamily B in Arabidopsis thaliana. It is a full-length protein consisting of 714 amino acids with an N-terminal His-tag when produced recombinantly. The protein is encoded by a gene that produces a membrane transporter involved in the movement of substances across cellular membranes using ATP hydrolysis as an energy source . ABC transporters constitute one of the largest protein families found in all living organisms, with plants encoding more than 100 ABC transporters, significantly exceeding the number found in other organisms .

What is the molecular structure and key domains of ABCB28?

ABCB28 from Arabidopsis thaliana has a molecular structure typical of ABC transporters, featuring nucleotide-binding domains (NBDs) that bind and hydrolyze ATP, and transmembrane domains (TMDs) that form the pathway through which substrates cross the membrane. The full amino acid sequence of ABCB28 (714 residues) includes several conserved motifs characteristic of ABC transporters .

The protein contains specific sequence elements that define its substrate specificity, including potentially the D/E-P motif that has been identified in other auxin-transporting ABCB proteins. This motif has been shown to be essential for auxin transport activities in related ABCB transporters and may play a similar role in ABCB28 .

How does ABCB28 compare to other ABCB transporters across plant species?

When comparing ABCB28 from Arabidopsis thaliana to its homologs in other plant species such as Paeonia ostii (PoABCB28), several similarities and differences can be observed:

CharacteristicArabidopsis ABCB28Paeonia ostii ABCB28
Length (amino acids)7141280
Molecular WeightNot specified in data140,874.21 Da
Isoelectric Point (pI)Not specified in data8.65
Predicted Subcellular LocationNot specified in dataPlasma membrane (plas: 14)

The Paeonia ostii ABCB28 is significantly larger than the Arabidopsis version, suggesting possible structural and functional differences despite being classified in the same subfamily . This comparison highlights the evolutionary diversity of ABCB transporters across plant species, which may relate to specialized functions in different plant lineages.

What expression systems are most effective for recombinant ABCB28 production?

For the production of recombinant ABCB28, E. coli has been successfully used as an expression system. The protein can be expressed as a full-length construct (amino acids 1-714) with an N-terminal His-tag to facilitate purification . E. coli provides several advantages for ABCB28 expression:

  • High protein yield due to rapid growth and high cell density cultures

  • Well-established protocols for induction and harvest

  • Compatibility with His-tag purification systems

  • Relatively low cost compared to eukaryotic expression systems

For optimal expression, researchers should consider:

  • Using BL21(DE3) or similar E. coli strains optimized for protein expression

  • Testing different induction conditions (IPTG concentration, temperature, duration)

  • Evaluating the effect of molecular chaperones to enhance proper folding

  • Optimizing growth media composition to maximize yield

What purification and storage protocols maximize ABCB28 stability?

Purification of recombinant ABCB28 from E. coli typically involves affinity chromatography utilizing the N-terminal His-tag. The purified protein should be handled carefully to maintain its structural integrity and functional activity .

Recommended purification protocol:

  • Cell lysis using sonication or pressure-based methods in the presence of protease inhibitors

  • Clarification of lysate by centrifugation

  • Affinity chromatography using Ni-NTA or similar matrices

  • Washing with increasing imidazole concentrations

  • Elution with high imidazole buffer

  • Buffer exchange and concentration

Optimal storage conditions:

  • Store at -20°C/-80°C upon receipt

  • Aliquot to avoid repeated freeze-thaw cycles, which can denature the protein

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for long-term storage

  • For working aliquots, store at 4°C for up to one week

The lyophilized powder form of recombinant ABCB28 maintains greater stability during long-term storage, while the reconstituted protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0 provides a suitable environment for maintaining the protein's native conformation .

What is the current understanding of ABCB28's physiological role in Arabidopsis?

While the specific physiological role of ABCB28 in Arabidopsis has not been extensively characterized according to the provided search results, insights can be drawn from research on related ABCB transporters. ABC transporters in plants fulfill diverse functions including:

  • Detoxification processes

  • Organ growth regulation

  • Plant nutrition

  • Developmental processes

  • Response to abiotic stresses

  • Pathogen resistance

  • Environmental interactions

Several ABCB transporters in Arabidopsis have been identified as auxin transporters, containing a conserved D/E-P motif essential for auxin transport activity . If ABCB28 contains this motif, it may function in auxin transport pathways, potentially contributing to root or shoot development through the regulation of auxin distribution.

How do researchers determine the substrate specificity of ABCB28?

Determining the substrate specificity of ABCB28 requires multiple complementary approaches:

Transport assays in heterologous systems:

  • Expression in protoplasts (such as tobacco) followed by efflux/influx measurements with radiolabeled potential substrates

  • Xenopus oocyte expression systems with two-electrode voltage clamp recordings

  • Reconstitution in liposomes with fluorescent substrate analogs

Structural analysis:

  • Identification of conserved motifs, such as the D/E-P motif present in known auxin transporters

  • Site-directed mutagenesis of key residues to assess their impact on transport function

  • Homology modeling based on related transporters with known structures

In planta approaches:

  • Phenotypic analysis of knockout/overexpression lines

  • Complementation studies in mutant backgrounds

  • Transport measurements in plant tissues

Research on other ABCB transporters has demonstrated that the D/E-P motif is not only essential for auxin transport activities but is also sufficient to introduce significant auxin transport capacity to other transporters like the malate-transporting ABCB14 . Similar methodological approaches could be applied to determine whether ABCB28 transports auxin or other substrates.

How can ABCB28 be used to study membrane transport mechanisms in plants?

ABCB28 represents a valuable model for studying fundamental aspects of membrane transport mechanisms in plants. Advanced research applications include:

Structure-function relationship studies:

  • Generation of chimeric proteins between ABCB28 and other transporters to identify domains responsible for substrate specificity

  • Cryo-electron microscopy to determine the 3D structure in different conformational states

  • Analysis of ATP binding and hydrolysis cycles through ATPase activity assays

Transport kinetics and energetics:

  • Determination of transport rates, substrate affinity, and maximum velocity

  • Assessment of the stoichiometry between ATP hydrolysis and substrate transport

  • Investigation of potential regulatory mechanisms affecting transport activity

Protein-protein interactions:

  • Identification of interaction partners through co-immunoprecipitation or yeast two-hybrid screens

  • Analysis of potential regulatory complexes that modulate ABCB28 activity

  • Investigation of trafficking and membrane localization mechanisms

These approaches can provide insights not only into ABCB28 function but also into general principles of ABC transporter mechanism, contributing to a broader understanding of membrane transport in plant cells.

What genetic approaches are most informative for studying ABCB28 function in planta?

Several genetic approaches can be employed to elucidate ABCB28 function in Arabidopsis:

Loss-of-function approaches:

  • T-DNA insertion mutants or CRISPR/Cas9-generated knockout lines

  • RNA interference (RNAi) or artificial microRNA (amiRNA) for conditional knockdown

  • Chemical genetics using specific inhibitors of ABCB transporters

Gain-of-function approaches:

  • Overexpression under constitutive or tissue-specific promoters

  • Expression of hyperactive variants through mutation of regulatory domains

  • Complementation with native or modified versions in knockout backgrounds

Reporter systems:

  • Fusion with fluorescent proteins to track subcellular localization

  • Promoter-reporter constructs to analyze expression patterns

  • Sensors for potential substrates to visualize transport activity in vivo

Research on related ABCB transporters has employed artificial microRNA approaches (such as the amiR-2572 mentioned in the search results) to study their role in auxin transport . Similar strategies could be applied to ABCB28 to determine its contribution to specific physiological processes.

How does ABCB28 function relate to plant stress responses and development?

The relationship between ABCB28 and plant stress responses or developmental processes requires sophisticated experimental approaches:

Stress response analysis:

  • Phenotypic evaluation of ABCB28 mutants under various stress conditions (drought, salt, pathogen infection)

  • Transcriptomic and metabolomic profiling of wild-type versus mutant plants under stress

  • Assessment of hormone levels and signaling pathway activation in response to stress

Developmental studies:

  • Detailed phenotypic characterization throughout the plant life cycle

  • Cell-type specific expression analysis using fluorescence-activated cell sorting (FACS)

  • Time-course studies during key developmental transitions

Integration with hormone pathways:

  • Analysis of potential interactions with auxin transport and signaling

  • Investigation of cross-talk with other hormone pathways

  • Root clock studies to determine involvement in periodic growth processes

ABC transporters in plants are known to play roles in organ growth, development, and stress responses . If ABCB28 functions as an auxin transporter like some of its family members, it may contribute to developmental processes through regulation of auxin distribution, potentially feeding into the root clock mechanism as described for other ABCB transporters .

What are the main technical difficulties in working with membrane proteins like ABCB28?

Working with ABCB28 presents several technical challenges common to membrane protein research:

Expression and purification challenges:

  • Low expression levels compared to soluble proteins

  • Proper folding and insertion into membranes

  • Maintaining protein stability during extraction from membranes

  • Obtaining sufficient quantities for structural studies

Functional assay limitations:

  • Designing appropriate transport assays that mimic physiological conditions

  • Distinguishing direct from indirect effects in complex systems

  • Accounting for the influence of the lipid environment on protein function

  • Measuring transport of hydrophobic substrates across membranes

Structural analysis constraints:

  • Difficulties in obtaining crystals for X-ray crystallography

  • Challenges in maintaining native conformation during sample preparation

  • Resolution limitations in membrane protein structures

  • Dynamic conformational changes during the transport cycle

To address these challenges, researchers often employ a combination of approaches, including optimized expression systems, detergent screening, lipid reconstitution, and advanced imaging techniques such as cryo-electron microscopy.

How can researchers overcome solubility and stability issues with recombinant ABCB28?

Improving the solubility and stability of recombinant ABCB28 requires strategic approaches:

Optimization of expression conditions:

  • Testing different E. coli strains (e.g., C41(DE3), C43(DE3)) specifically designed for membrane proteins

  • Exploring lower expression temperatures (16-25°C) to slow production and improve folding

  • Using milder induction conditions with lower IPTG concentrations

  • Co-expression with molecular chaperones to assist proper folding

Solubilization strategies:

  • Screening multiple detergents to identify optimal extraction conditions

  • Using detergent mixtures or novel amphipathic agents (nanodiscs, SMALPs)

  • Incorporating stabilizing additives during extraction and purification

  • Testing detergent-free methods like styrene-maleic acid copolymer extraction

Stability enhancement:

  • Addition of specific lipids that interact with ABCB28

  • Inclusion of substrate or inhibitor during purification to stabilize specific conformations

  • Engineering stability-enhancing mutations based on homology modeling

  • Using trehalose (6%) in storage buffer as mentioned in the existing protocol

These approaches can significantly improve the yield and quality of recombinant ABCB28, enabling more detailed functional and structural studies.

What are the most promising future research directions for ABCB28?

Future research on ABCB28 could focus on several promising directions:

Functional characterization:

  • Comprehensive substrate profiling to determine transport specificity

  • Investigation of potential roles in auxin transport based on the presence of the D/E-P motif

  • Elucidation of physiological functions through detailed phenotypic analysis of mutants

  • Integration into known signaling and transport networks

Structural biology:

  • Determination of high-resolution structures in different conformational states

  • Identification of substrate binding sites and translocation pathways

  • Structural comparison with other ABCB transporters to understand functional diversity

  • Analysis of potential homo- or heterodimerization with other transporters

Translational applications:

  • Development as a model system for understanding transport mechanisms

  • Exploration of potential roles in agricultural applications such as stress resistance

  • Investigation of comparative functions across species to understand evolutionary adaptation

The rapid advancement of techniques such as cryo-electron microscopy, single-molecule studies, and genome editing provides unprecedented opportunities to address these research questions and expand our understanding of ABCB28's role in plant biology.

How does current ABCB28 research integrate with broader plant biology questions?

ABCB28 research contributes to several fundamental questions in plant biology:

Transport system integration:

  • How do different transporter families coordinate to regulate the movement of molecules within plants?

  • What is the hierarchy of redundancy and specificity among related transporters?

  • How do membrane transporters contribute to cellular homeostasis and compartmentalization?

Developmental regulation:

  • How do transport processes contribute to organ formation and growth?

  • What role do transporters play in establishing and maintaining developmental gradients?

  • How are transporters themselves regulated during different developmental stages?

Environmental adaptation:

  • How do plants modulate transport processes in response to environmental changes?

  • What role do ABC transporters play in stress tolerance and adaptation?

  • How has transporter function evolved across species adapted to different environments?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.