Recombinant Arabidopsis thaliana ABC transporter G family member 10 (ABCG10)

Shipped with Ice Packs
In Stock

Description

Introduction to ATP-Binding Cassette (ABC) Transporters in Plants

ATP-binding cassette (ABC) transporters represent one of the largest and most ancient protein superfamilies, with members present across all kingdoms of life. These membrane-spanning proteins utilize ATP hydrolysis to transport diverse substrates across biological membranes. The plant genome encodes significantly more ABC transporters than found in other organisms, with Arabidopsis thaliana alone containing more than 130 ABC transporter genes . These transporters are localized in various cellular membranes including the plasma membrane, tonoplast, chloroplasts, mitochondria, and peroxisomes .

ABC transporters were initially identified for their roles in detoxification processes but have subsequently been shown to participate in crucial plant processes including organ growth, nutrition, development, abiotic stress responses, pathogen resistance, and environmental interactions . Their diverse substrate specificity allows them to transport compounds such as surface lipids, phytate, and phytohormones like auxin and abscisic acid .

Classification and Structure of Plant ABC Transporters

Plant ABC transporters are classified into eight subfamilies (A-I) based on domain organization and phylogenetic relationships. The ABCG subfamily, which includes ABCG10, is particularly extensive in plants and can be subdivided into half-size and full-size transporters . The half-size ABCG transporters, also known as white-brown complex (WBC) proteins, contain a single nucleotide-binding domain (NBD) and a single transmembrane domain (TMD), while full-size transporters have two of each domain .

The general architecture of ABC transporters includes:

  • Nucleotide-binding domains (NBDs) that bind and hydrolyze ATP

  • Transmembrane domains (TMDs) that form the substrate translocation pathway

  • Regulatory domains in some transporters that modulate activity

Structure and Characteristics of Arabidopsis thaliana ABCG10

ABCG10, also known as WBC10 or AtWBC10, is encoded by the At1g53270 gene in Arabidopsis thaliana . It belongs to the half-size ABCG transporters with a single NBD and TMD arrangement.

Subcellular Localization

ABCG10 is primarily localized to the plasma membrane, consistent with its proposed role in transporting substrates across the cell membrane . This localization has been confirmed through expression of fluorescently tagged ABCG proteins in plant cells .

Recombinant Production of ABCG10

Recombinant production of Arabidopsis thaliana ABCG10 has been achieved in several expression systems, providing valuable research tools for functional and structural studies.

Expression Systems

The most common expression system for recombinant ABCG10 production is Escherichia coli, which allows for relatively high yield and simplified purification strategies . Alternative expression systems include:

  1. Pichia pastoris (methylotrophic yeast) - demonstrated to be effective for plant ABC transporters, ensuring proper folding and processing

  2. Plant-based expression systems - provide native post-translational modifications

  3. Insect cell expression systems - balance between yield and proper folding

Phylogenetic Relationship to Other ABCG Transporters

Phylogenetic analysis places ABCG10 within a clade of ABCG transporters implicated in various aspects of plant development and defense. In maize (Zea mays), the ABCG10 homolog ZmABCG10 (Zm00001d044476) is located on chromosome 3 and consists of 609 amino acids . Another homolog, ZmABCG23, is also annotated as an ABCG10-like protein in maize .

Expression Pattern

ABCG10 shows a specific expression pattern across different plant tissues and developmental stages. Based on the comparison with other ABCG family members, ABCG10 is likely expressed in:

  1. Vascular tissues

  2. Root tissues

  3. Reproductive organs

  4. Developing seeds

This expression pattern suggests potential roles in vascular transport, nutrient mobilization, and development.

Potential Functional Roles

While the specific function of Arabidopsis ABCG10 has not been fully characterized, studies of related family members and homologs in other species provide insights into its potential roles:

  1. Transport of specialized metabolites: Related ABCG transporters are involved in the transport of phenylpropanoids and other specialized metabolites .

  2. Defense responses: The Medicago truncatula homolog MtABCG10 shows elevated expression following application of fungal oligosaccharides, suggesting a role in plant defense responses .

  3. Suberin and lipid transport: Several ABCG family members function in transporting lipid precursors for formation of protective barriers like suberin and cutin .

  4. Hormone transport: Some ABCG transporters are involved in phytohormone transport, including ABA, auxin, cytokinin, and strigolactones .

In Medicago truncatula, silencing of MtABCG10 resulted in lower accumulation of the phenylpropanoid pathway-derived medicarpin and its precursors, suggesting that this homolog is involved in the transport of these defense compounds . Infection studies with Fusarium oxysporum showed that the pathogen progressed faster in MtABCG10-silenced plants compared to controls, further supporting a role in plant defense .

Functional Diversity of ABCG Transporters

The ABCG subfamily in Arabidopsis and other plants is involved in diverse biological processes as shown in Table 2:

ABCG MemberSpeciesFunctionReference
ABCG11/WBC11A. thalianaTransport of cutin and wax precursors
ABCG12/CER5A. thalianaWax transport in shoot epidermis
ABCG13A. thalianaCutin formation in flowers
ABCG2/6/20A. thalianaSuberin formation in roots and seed coats
ABCG32/PEC1A. thalianaHydroxylated fatty acid incorporation in cuticular layer
ABCG29A. thalianaExport of monolignols for lignin biosynthesis
ABCG46 (formerly ABCG10)M. truncatulaTransport of phenylpropanoids (4-coumarate and liquiritigenin)
MtABCG10M. truncatulaDefense response related to phenylpropanoid pathway

Table 2: Functional diversity of ABCG transporters in plants

Agricultural and Biotechnological Applications

Understanding ABCG10 function has potential applications in:

  1. Crop improvement: Engineering plants with enhanced disease resistance through modulation of defense compound transport.

  2. Stress tolerance: Improving plant responses to environmental stresses by manipulating transport of protective compounds.

  3. Metabolic engineering: Enhancing production of valuable specialized metabolites through optimized transport.

Future Research Directions

Several key questions remain regarding ABCG10 function and could be addressed in future research:

  1. Substrate identification: Determination of the specific substrates transported by ABCG10 using recombinant protein in transport assays.

  2. Structure-function relationships: Identification of key residues that determine substrate specificity and transport efficiency.

  3. Regulatory mechanisms: Investigation of how ABCG10 activity is regulated by post-translational modifications, interaction partners, or environmental factors.

  4. Physiological roles: Further characterization of phenotypes in ABCG10 knockout or overexpression plants to understand its biological functions.

  5. Comparative studies: Analysis of ABCG10 orthologs across plant species to understand evolutionary conservation and divergence.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
ABCG10; WBC10; At1g53270; F12M16.17; ABC transporter G family member 10; ABC transporter ABCG.10; AtABCG10; Probable white-brown complex homolog protein 10; AtWBC10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-590
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ABCG10
Target Protein Sequence
MELPVKAPIPGGREISYRLETKNLSYRIGGNTPKFSNLCGLLSEKEEKVILKDVSCDARS AEITAIAGPSGAGKTTLLEILAGKVSHGKVSGQVLVNGRPMDGPEYRRVSGFVPQEDALF PFLTVQETLTYSALLRLKTKRKDAAAKVKRLIQELGLEHVADSRIGQGSRSGISGGERRR VSIGVELVHDPNVILIDEPTSGLDSASALQVVTLLKDMTIKQGKTIVLTIHQPGFRILEQ IDRIVLLSNGMVVQNGSVYSLHQKIKFSGHQIPRRVNVLEYAIDIAGSLEPIRTQSCREI SCYGHSKTWKSCYISAGGELHQSDSHSNSVLEEVQILGQRSCKNIFRTKQLFTTRALQAS IAGLILGSIYLNVGNQKKEAKVLRTGFFAFILTFLLSSTTEGLPIFLQDRRILMRETSRR AYRVLSYVLADTLIFIPFLLIISMLFATPVYWLVGLRRELDGFLYFSLVIWIVLLMSNSF VACFSALVPNFIMGTSVISGLMGSFFLFSGYFIAKDRIPVYWEFMHYLSLFKYPFECLMI NEYRGDVFLKQQDLKESQKWSNLGIMASFIVGYRVLGFFILWYRCYRTRS
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G53270

STRING: 3702.AT1G53270.1

UniGene: At.66897

Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is ABCG10 and what is its function in Arabidopsis thaliana?

ABCG10 belongs to the ATP-binding cassette G subfamily of transporters in Arabidopsis thaliana. ABC transporters are membrane-bound proteins that utilize ATP hydrolysis to transport various substrates across cellular membranes. While specific information on ABCG10 is limited in the current literature, ABC transporters in the G subfamily are known to play crucial roles in plant development and response to environmental stimuli.

Based on research with other ABCG family members, ABCG10 likely functions in specialized metabolite transport, possibly related to lipid translocation, hormone transport, or defense compound movement. For instance, other ABCG transporters like ABCG33/PDR5 have been implicated in processes associated with lignification in Arabidopsis stems .

Research methodology for determining ABCG10 function typically involves:

  • T-DNA insertion mutant analysis

  • Overexpression studies

  • Complementation assays

  • Metabolite profiling comparing wild-type and mutant plants

How is ABCG10 expression regulated in Arabidopsis thaliana?

Understanding ABCG10 regulation requires investigation of both transcriptional and post-transcriptional mechanisms. Based on studies of related ABC transporters, ABCG10 expression likely responds to developmental and environmental cues.

To study ABCG10 regulation, researchers can employ the following approaches:

  • Promoter analysis: Cloning the ABCG10 promoter region (typically 1-2kb upstream of the translation start site) and generating promoter::reporter constructs (e.g., promoter::GUS) to visualize expression patterns. This approach has been successfully used for other ABC transporters including ABCG33, ABCB11, ABCB14, and ABCB15 .

  • Transcription factor binding site identification: Analyzing the promoter sequence for cis-regulatory elements that may bind known transcription factors.

  • Response to hormone treatment: Monitoring expression changes following application of plant hormones such as auxin, which has been implicated in regulating other ABC transporters .

  • Epigenetic regulation: Investigating DNA methylation patterns and histone modifications in the ABCG10 promoter region under different conditions.

In which tissues of Arabidopsis thaliana is ABCG10 expressed?

While specific ABCG10 expression data is limited in the provided literature, research on other ABC transporters in Arabidopsis provides methodological approaches for investigating tissue-specific expression patterns:

  • Promoter::GUS fusion assays: By generating transgenic plants containing the ABCG10 promoter fused to the β-glucuronidase (GUS) reporter gene, researchers can visualize tissue-specific expression patterns through histochemical staining. This approach has revealed that many ABC transporters in the B and G subfamilies are expressed in vascular tissues of the primary stem .

  • Fluorescent reporter systems: Similar to GUS assays, but using fluorescent proteins like GFP, which allow for live imaging without destructive sampling.

  • Quantitative RT-PCR: Tissue-specific RNA extraction followed by qRT-PCR to quantify ABCG10 transcript levels across different plant tissues and developmental stages.

  • RNA in situ hybridization: For high-resolution localization of ABCG10 transcripts within specific tissues.

Based on patterns observed with other ABCG transporters, ABCG10 may be expressed in vascular tissues, particularly those undergoing secondary wall formation or involved in specialized metabolite transport .

What experimental approaches are most effective for studying ABCG10 function in Arabidopsis?

Investigating ABCG10 function requires a multi-faceted approach combining genetic, biochemical, and cell biological techniques:

  • Genetic approaches:

    • T-DNA insertion mutant analysis: Identifying homozygous knockout lines and characterizing their phenotypes under various conditions

    • CRISPR/Cas9-mediated gene editing: For precise modifications of the ABCG10 gene

    • Overexpression studies using constitutive (35S) or tissue-specific promoters

    • Complementation assays in knockout backgrounds using wild-type or modified versions of ABCG10

  • Biochemical approaches:

    • Recombinant protein production: Expressing and purifying recombinant ABCG10 (full or partial) for in vitro transport assays

    • Transport assays using radiolabeled or fluorescently-labeled potential substrates

    • ATPase activity measurements to assess transporter functionality

  • Cell biological approaches:

    • Subcellular localization using fluorescent protein fusions

    • Co-localization studies with known membrane markers

    • Immunogold electron microscopy for high-resolution localization

  • Physiological approaches:

    • Phenotypic analysis of mutants under various environmental conditions

    • Metabolite profiling using liquid chromatography-mass spectrometry (LC-MS)

    • Measurement of transport rates in isolated membrane vesicles

Generating knockout lines:

  • T-DNA insertion lines:

    • Screen publicly available T-DNA insertion collections (SALK, SAIL, GABI-Kat)

    • Identify lines with insertions in the ABCG10 coding sequence

    • Confirm homozygosity through PCR genotyping with gene-specific and T-DNA border primers

    • Verify knockout status through RT-PCR and/or Western blotting

  • CRISPR/Cas9-mediated gene editing:

    • Design sgRNAs targeting ABCG10 exons

    • Transform Arabidopsis with CRISPR/Cas9 constructs via Agrobacterium-mediated transformation

    • Screen transformants for mutations and identify homozygous knockout lines

    • Confirm the absence of off-target mutations through whole-genome sequencing

Generating overexpression lines:

  • Cloning strategies:

    • Amplify the full-length ABCG10 coding sequence from cDNA

    • Clone into a binary vector under a constitutive (e.g., 35S) or inducible promoter

    • Transform Arabidopsis using the floral dip method

    • Select transformants on appropriate selection media

  • Validation methods:

    • Confirm transgene integration by PCR

    • Measure transcript levels by qRT-PCR

    • Verify protein expression through Western blotting

    • Assess phenotypic changes compared to wild-type plants

How can I analyze ABCG10 promoter activity in different tissues?

Detailed promoter analysis requires a combination of bioinformatic and experimental approaches:

  • Promoter cloning and reporter construction:

    • Amplify approximately 1-2kb upstream of the ABCG10 translation start site

    • Clone the promoter fragment into a binary vector upstream of a reporter gene (GUS or fluorescent protein)

    • Transform Arabidopsis via the floral dip method or spraying

    • Select transformants on appropriate selection media (e.g., hygromycin at 30 μg/ml)

  • Histochemical GUS staining protocol:

    • Incubate tissues in 90% acetone for 30 min under vacuum

    • Rinse three times with buffer containing 50 mM Na-phosphate buffer (pH 7.0), 500 nM Fe(CN), and 0.1% Triton X-100

    • Incubate with 1 mM X-Gluc in buffer at 37°C overnight

    • Clear tissues with 50% ethanol

  • Fluorescent GUS detection:

    • For higher sensitivity, incubate longitudinally dissected stems with 50 μM C12-fluorescein di-β-D-glucuronide at room temperature for 3 hours

    • Observe using fluorescence microscopy to detect yellow-green emission

  • Sectioning for detailed analysis:

    • Transfer GUS-stained tissues to 100% acetone

    • Infiltrate with resin through a graded series

    • Polymerize and section at 1-2 μm thickness

    • View sections with compound microscopy

  • Quantitative analysis:

    • Use image analysis software to quantify staining intensity across different tissues

    • Correlate promoter activity with developmental stages or treatments

What methodologies are best for studying ABCG10 substrate specificity?

Determining ABCG10 substrates requires multiple complementary approaches:

  • Transport assays using recombinant protein:

    • Express recombinant ABCG10 in heterologous systems (e.g., yeast, insect cells)

    • Prepare membrane vesicles containing the recombinant protein

    • Perform transport assays with radiolabeled or fluorescently-labeled potential substrates

    • Measure ATP-dependent accumulation of substrates in vesicles

  • In planta approaches:

    • Compare metabolite profiles between wild-type and ABCG10 knockout plants using LC-MS

    • Perform feeding experiments with labeled potential substrates

    • Monitor substrate movement/accumulation in different tissues

  • Binary pattern multitarget analysis:

    • Analyze molecular substructures that correlate with transport activity

    • Apply computational approaches similar to those used in ABC transporter inhibitor studies

    • Predict potential substrates based on structural similarities

  • Competitive inhibition assays:

    • Test competitive inhibition between known substrates of related transporters and candidate ABCG10 substrates

    • Measure transport kinetics (Km, Vmax) for confirmed substrates

What role does ABCG10 play in plant response to environmental stresses?

Investigating ABCG10's role in stress responses requires systematic phenotypic and molecular analyses:

  • Stress exposure experiments:

    • Subject wild-type and ABCG10 mutant plants to various stresses (drought, salt, pathogen infection, heat)

    • Monitor phenotypic responses, survival rates, and stress marker expression

    • Measure specific physiological parameters relevant to each stress type

  • Transcriptomic analysis:

    • Perform RNA-seq comparing wild-type and mutant plants under control and stress conditions

    • Identify differentially expressed genes and affected pathways

    • Validate key findings through qRT-PCR

  • Metabolomic profiling:

    • Analyze changes in metabolite profiles under stress conditions

    • Compare wild-type and ABCG10 mutant responses

    • Identify metabolites whose transport or accumulation may be affected by ABCG10

  • Hormone signaling analysis:

    • Measure hormone levels (ABA, jasmonate, salicylic acid) in response to stress

    • Assess sensitivity of ABCG10 mutants to exogenous hormone application

    • Investigate potential role of ABCG10 in hormone transport or signaling

How does ABCG10 function compare to other ABC transporters in Arabidopsis?

Understanding ABCG10 in the context of other ABC transporters requires comprehensive comparative analysis:

  • Phylogenetic analysis:

    • Construct phylogenetic trees of ABC transporters in Arabidopsis

    • Identify closest relatives of ABCG10 and their known functions

    • Analyze evolutionary relationships within the ABCG subfamily

  • Expression pattern comparison:

    • Compare tissue-specific expression patterns of ABCG10 with other ABC transporters

    • Identify co-expressed transporters that may function in similar processes

    • Analyze expression under various conditions to identify functional groups

  • Mutant phenotype comparison:

    • Compare phenotypes of single and combined ABC transporter mutants

    • Test for functional redundancy through genetic analysis

    • Create double/triple mutants to uncover masked phenotypes

  • Substrate specificity analysis:

    • Compare substrate ranges of different ABC transporters

    • Identify unique and overlapping substrates

    • Test cross-complementation between different transporter mutants

How are ABC transporters, including ABCG10, involved in vascular development in Arabidopsis?

ABC transporters play important roles in vascular development, particularly through auxin transport and lignification processes:

  • Vascular pattern analysis:

    • Examine vascular bundle organization in ABCG10 mutants using microscopy

    • Compare with other ABC transporter mutants that show vascular phenotypes

    • Analyze cell type-specific markers to identify affected cell lineages

  • Auxin transport studies:

    • Measure polar auxin transport in stems of ABCG10 mutants compared to wild-type

    • Analyze auxin distribution using DR5::GUS or DR5::GFP reporter lines

    • Compare with known auxin transport-related ABC transporters like ABCB14 and ABCB15, which show reduced polar auxin transport and altered vascular development when mutated

  • Lignification analysis:

    • Analyze lignin content and composition in ABCG10 mutants

    • Perform histochemical staining for lignin (phloroglucinol-HCl)

    • Compare expression patterns with other ABC transporters coordinately expressed during lignification, such as ABCB11, ABCB14, ABCB15, and ABCG33

ABC TransporterEffect on Auxin TransportVascular PhenotypeLignification Effect
ABCB14Decreased polar transportDisorganized vasculature, decreased phloem area, reduced xylem vessel lumen diameterAssociated with lignification processes
ABCB15Decreased polar transportMild alterationsAssociated with lignification processes
ABCG33Not observedNot reportedExpressed during lignification
ABCB11Not reportedNot reportedExpressed during lignification
ABCG10To be determinedTo be determinedPotential role based on subfamily functions

What evolutionary insights can be gained from comparing ABCG10 across different plant species?

Evolutionary analysis provides context for understanding ABCG10 function and adaptation:

  • Ortholog identification:

    • Identify ABCG10 orthologs in other plant species through reciprocal BLAST searches

    • Construct phylogenetic trees to confirm orthology relationships

    • Analyze sequence conservation patterns, particularly in functional domains

  • Selection pressure analysis:

    • Calculate Ka/Ks ratios to identify regions under purifying or positive selection

    • Compare selection patterns across different plant lineages

    • Identify potential adaptive changes in specific environments

  • Expression pattern evolution:

    • Compare expression patterns of ABCG10 orthologs in different species

    • Identify conserved and divergent regulatory elements

    • Analyze correlation between expression pattern changes and environmental adaptation

  • Functional validation across species:

    • Test functional complementation of Arabidopsis ABCG10 mutants with orthologs from other species

    • Compare transport specificities and biochemical properties of orthologs

    • Investigate species-specific adaptations in transporter function

What insights from human ABC transporter research can be applied to studying ABCG10 in Arabidopsis?

Research on human ABC transporters, particularly in disease contexts, offers valuable methodological approaches for plant studies:

  • Structural insights:

    • Apply structural analysis techniques from human ABC transporter studies to model ABCG10

    • Identify critical residues involved in substrate binding and ATP hydrolysis

    • Design targeted mutations based on human transporter structure-function relationships

  • Transport mechanism studies:

    • Adapt methodologies used to study transport kinetics in human ABC transporters

    • Apply techniques such as inside-out vesicle preparations and ATPase assays

    • Develop high-throughput screening approaches similar to those used for human transporter inhibitors

  • Disease-relevant approaches:

    • Apply methodologies from studies of ABC transporters in Alzheimer's disease to investigate plant stress responses

    • Adapt approaches used to study diagnostic and prognostic value of ABC transporters in cancer to plant developmental analysis

    • Utilize systems biology approaches to identify transporter interaction networks

  • Inhibitor studies:

    • Leverage knowledge of human ABC transporter inhibitors to develop tools for studying plant transporters

    • Design inhibitor compounds based on binary pattern datasets of ABC transporter inhibitors

    • Test effects of inhibitors on plant growth, development, and stress responses

How can recombinant ABCG10 be effectively produced and purified for functional studies?

Production of high-quality recombinant ABCG10 protein is essential for biochemical and structural studies:

  • Expression system selection:

    • Evaluate different expression systems (E. coli, yeast, insect cells, plant cell cultures)

    • For full-length membrane proteins like ABCG10, eukaryotic expression systems are often preferable

    • Consider using partial constructs (e.g., nucleotide-binding domain only) for specific studies

  • Construct design:

    • Include affinity tags (His, FLAG, Strep) for purification

    • Consider fusion proteins to enhance solubility and expression

    • Design constructs with native signal sequences for proper membrane insertion

  • Optimization of expression conditions:

    • Test different induction methods, temperatures, and durations

    • Optimize media composition and additives

    • Screen for detergents that maintain protein stability and activity

  • Purification strategies:

    • Solubilize membrane fractions with appropriate detergents

    • Utilize affinity chromatography followed by size exclusion chromatography

    • Verify protein quality through SDS-PAGE, Western blotting, and functional assays

  • Activity verification:

    • Measure ATPase activity of purified protein

    • Perform reconstitution into proteoliposomes for transport assays

    • Assess substrate binding through fluorescence-based or radiolabeled ligand binding assays

What emerging technologies could advance our understanding of ABCG10 function?

Several cutting-edge technologies hold promise for elucidating ABCG10 function:

  • Cryo-electron microscopy:

    • Determine high-resolution structures of ABCG10 in different conformational states

    • Visualize substrate binding and the transport mechanism

    • Compare structural features with other ABC transporters

  • Single-molecule techniques:

    • Apply fluorescence resonance energy transfer (FRET) to study conformational changes during transport

    • Use single-molecule force spectroscopy to investigate transporter mechanics

    • Develop single-molecule tracking in live cells to study dynamics and interactions

  • Advanced imaging approaches:

    • Implement super-resolution microscopy to visualize ABCG10 distribution at the subcellular level

    • Apply light sheet microscopy for whole-organ imaging of fluorescently tagged ABCG10

    • Utilize correlative light and electron microscopy for multi-scale structural analysis

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data to build comprehensive models of ABCG10 function

    • Apply machine learning approaches to predict substrate specificity and functional partners

    • Develop network models of ABC transporter coordination in plant development and stress responses

How can binary pattern analysis be applied to predict ABCG10 substrates and inhibitors?

Binary pattern analysis represents a promising approach for predicting ABCG10 interactions:

  • Dataset development:

    • Create a binary pattern multitarget dataset for plant ABC transporters similar to those developed for human transporters

    • Analyze molecular substructures in a statistical binary pattern distribution scheme

    • Include data from known substrates and inhibitors of related transporters

  • Pattern recognition approaches:

    • Apply machine learning algorithms to identify structural patterns associated with transport

    • Develop predictive models for substrate and inhibitor binding

    • Validate predictions through experimental testing

  • Integration with structural information:

    • Combine binary pattern analysis with molecular docking studies

    • Identify key interaction residues for substrate recognition

    • Design targeted mutations to alter specificity based on predictions

  • Application to drug discovery:

    • Identify compounds that may interact with both plant and human ABC transporters

    • Develop plant-based screening systems for potential therapeutic compounds

    • Explore agricultural applications for modulating plant development and stress responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.