Recombinant Arabidopsis thaliana ABC transporter G family member 13 (ABCG13)

Shipped with Ice Packs
In Stock

Description

Overview of ABCG13

ABCG13 is a half-size ABC transporter belonging to the ABCG subfamily, which plays critical roles in cuticle formation and floral development in Arabidopsis thaliana. It is encoded by the AT1G51460 locus and is also known as FOLDED PETALS 2 (FOP2) due to its role in petal elongation . Recombinant ABCG13 enables researchers to investigate its substrate specificity, dimerization partners, and transport mechanisms in vitro.

Production of Recombinant ABCG13

Recombinant ABCG13 is commercially available in multiple expression systems, enabling flexibility for experimental applications :

Product CodeExpression SystemFeatures
CSB-YP874918DOA1YeastHigh purity; suitable for structural studies.
CSB-EP874918DOA1E. coliCost-effective; includes a His-tag for purification.
CSB-EP874918DOA1-BE. coliBiotinylated via AviTag technology for pull-down assays.
CSB-BP874918DOA1BaculovirusPost-translational modifications mimic native eukaryotic proteins.
CSB-MP874918DOA1Mammalian cellIdeal for functional studies in mammalian systems.

Research Applications

  1. Functional Characterization:

    • Heterologous expression in yeast or E. coli allows ATPase activity assays and substrate screening .

    • Biotinylated variants (e.g., CSB-EP874918DOA1-B) facilitate protein interaction studies .

  2. Genetic Complementation:

    • Recombinant ABCG13 can rescue petal elongation defects in fop2 mutants, confirming its role in cuticle secretion .

  3. Cuticle Permeability Studies:

    • Used to investigate how cuticle defects impact plant responses to pathogens and abiotic stress .

Key Research Findings

  • Petal Morphogenesis: ABCG13 is critical for petals to elongate smoothly through tight floral bud spaces. Mutants exhibit physical friction-induced folding .

  • Cuticle Composition: ABCG13 knockdown reduces cutin monomers (e.g., C16 and C18 ω-hydroxy acids), leading to permeable cuticles .

  • Genetic Interactions: Double mutants (e.g., fop2 fop1) show synergistic defects, suggesting overlapping roles with other transporters in cuticle dynamics .

Future Directions

  • Substrate Identification: In vitro assays with purified recombinant ABCG13 are needed to confirm transported molecules .

  • Dimerization Partners: Co-expression studies could reveal whether ABCG13 functions as a homodimer or requires a partner (e.g., ABCG11/12) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
ABCG13; WBC13; At1g51460; F5D21.8; ABC transporter G family member 13; ABC transporter ABCG.13; AtABCG13; White-brown complex homolog protein 13; AtWBC13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-678
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ABCG13
Target Protein Sequence
MTTPEGAMYVAWEDLTVVIPNFGEGATKRLLNGVNGCGEPNRILAIMGPSGSGKSTLLDA LAGRLAGNVVMSGKVLVNGKKRRLDFGAAAYVTQEDVLLGTLTVRESISYSAHLRLPSKL TREEISDIVEATITDMGLEECSDRTIGNWHLRGISGGEKKRLSIALEVLTKPSLLFLDEP TSGLDSASAFFVVQILRNIASSGKTVVSSIHQPSGEVFALFDDLLLLSGGETVYFGEAES ATKFFGEAGFPCPSRRNPSDHFLRCVNSDFDNVTAALVESRRINDSSFSLHQLHETTNTL DPLDDIPTAEIRTTLVRKFKCSLYAAASRARIQEIASIVGIVTERKKGSQTNWWKQLRIL TQRSFINMSRDLGYYWMRIAVYIVLSICVGSIFFNVGRNHTNVMSTAACGGFMAGFMTFM SIGGFQSFIEEMKVFSRERLNGHYGVAVYTVSNLLSSLPFIILMCLSTSSITIYMVRFQS GGSHFFYNCLDLICAITTVESCMMMIASVVPNFLMGVMLGAGYIGIMVLSAGFFRFFPDL PMVFWRYPVSYINYGAWALQGAYKNEMIGVEYDSPLPLVPKMKGELILQTVLGINPESSK WLDLAVVMMILIGYRIAFFAILKFREKVFPVIHMLYTKRTLSHIQKRPSFRRMTPFPSRR YPVHHALSSQEGLNSPLH
Uniprot No.

Target Background

Gene References Into Functions
  1. ABCG13 is essential for the transport of flower cuticular lipids.[ABCG13] PMID: 21232060
Database Links

KEGG: ath:AT1G51460

STRING: 3702.AT1G51460.1

UniGene: At.37812

Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is ABCG13 and what is its function in Arabidopsis thaliana?

ABCG13 is an ATP-binding-cassette (ABC) transporter belonging to the G family in Arabidopsis thaliana. It functions primarily in the transport of flower cuticular lipids, playing a crucial role in the assembly of the plant's cuticle specifically in floral tissues . The protein is categorized as a half-size ABCG-type transporter that facilitates the extracellular secretion of cuticular components . Studies have demonstrated that ABCG13 is functionally related to other ABC transporters (ABCG11 and ABCG12) that are also involved in cuticular lipid transport, though ABCG13 appears to have flower-specific functions .

How is ABCG13 structurally characterized?

ABCG13 in Arabidopsis thaliana is a protein consisting of 678 amino acids with characteristic ATP-binding cassette domains . The full amino acid sequence includes nucleotide-binding domains (NBDs) that bind and hydrolyze ATP, providing energy for substrate transport, and transmembrane domains (TMDs) that form the pathway through which substrates are transported across the membrane . When expressed recombinantly, ABCG13 can be produced with an N-terminal histidine tag to facilitate purification and experimental manipulation . The protein contains specific motifs including Walker A and B motifs, signature sequences, and transmembrane helices that are characteristic of ABC transporters in the G subfamily .

What is the expression pattern of ABCG13 in Arabidopsis tissues?

ABCG13 exhibits a highly tissue-specific expression pattern in Arabidopsis thaliana. Research has demonstrated that ABCG13 is predominantly expressed in floral tissues, with particularly high expression levels in petals and carpels . This restricted expression pattern correlates with its specialized function in flower cuticle development. The tissue-specific expression distinguishes ABCG13 from some other ABC transporters that may show broader expression patterns across vegetative tissues . This flower-specific expression profile helps explain why abcg13 knockout mutations display phenotypes that are restricted to floral organs rather than affecting the entire plant body .

What genetic approaches are effective for studying ABCG13 function?

For investigating ABCG13 function, researchers have successfully employed multiple genetic approaches:

  • Knockout Mutants: Isolation of abcg13 knockout mutants from T-DNA insertion libraries provides a fundamental approach to study complete loss-of-function effects . These mutants can be genotyped using PCR-based methods with gene-specific and T-DNA border primers.

  • RNA Interference (RNAi): Construction of RNAi vectors targeting specific regions of the ABCG13 mRNA allows for controlled gene silencing and can produce partial knockdown phenotypes that might reveal dose-dependent functions .

  • Artificial microRNA (amiRNA): This approach offers highly specific gene silencing with potentially fewer off-target effects than conventional RNAi . Designing amiRNAs that target unique regions of ABCG13 can provide precise control over gene expression levels.

All three approaches have been successfully used to establish that ABCG13 loss-of-function results in cuticle-related phenotypes specifically in flowers, including inter-organ post-genital fusions and altered petal epidermis morphology .

How can recombinant ABCG13 protein be produced for biochemical studies?

Recombinant ABCG13 protein can be produced using heterologous expression systems, with E. coli being a well-established platform for this purpose . The methodological approach involves:

  • Gene Cloning: The full-length ABCG13 coding sequence (1-678 amino acids) is cloned into an appropriate expression vector containing an N-terminal histidine tag .

  • Protein Expression: The construct is transformed into E. coli expression strains optimized for membrane protein production. Expression conditions including temperature, IPTG concentration, and induction time require optimization for maximum yield .

  • Purification: The His-tagged ABCG13 protein can be purified using immobilized metal affinity chromatography (IMAC), typically with Ni-NTA resin, followed by additional purification steps such as size exclusion chromatography if needed .

  • Final Processing: The purified protein is often stored as a lyophilized powder to maintain stability for long-term storage .

This recombinant protein can then be used for biochemical characterization, substrate binding assays, and structural studies to elucidate the molecular mechanisms of ABCG13 function.

What phenotypic analyses are most informative for characterizing abcg13 mutants?

When characterizing abcg13 mutants, several phenotypic analyses yield particularly valuable insights:

These analyses collectively provide comprehensive insights into how ABCG13 contributes to flower cuticle development and floral morphology.

How does ABCG13 functionally interact with other ABC transporters in cuticle formation?

  • Substrate Specificity Differentiation: While ABCG11 and ABCG12 appear to have broader roles in cuticular lipid transport across various plant tissues, ABCG13 demonstrates specificity for flower cuticular components . This suggests a division of labor based on substrate specificity or tissue context.

  • Potential Heterodimer Formation: As half-size ABC transporters, these proteins may form functional heterodimers. It remains to be determined whether ABCG13 can form heterodimers with ABCG11 or ABCG12, or if it primarily functions as a homodimer .

  • Compensatory Mechanisms: Research into the relative expression patterns and potential compensatory upregulation when one transporter is absent would provide insights into their functional redundancy and specialization.

Advanced approaches to investigate these interactions include co-immunoprecipitation studies, fluorescence resonance energy transfer (FRET) analyses between tagged transporters, and comprehensive lipidomic profiling of single and combinatorial mutants .

What are the structural determinants of ABCG13 substrate specificity?

Understanding the structural elements that determine ABCG13's preference for flower cuticular lipids requires sophisticated structural and functional analyses:

  • Domain Swapping Experiments: Creating chimeric proteins with domains exchanged between ABCG13 and related transporters (ABCG11/ABCG12) can help identify regions responsible for flower-specific substrate recognition.

  • Site-Directed Mutagenesis: Systematic mutation of conserved and non-conserved residues in the transmembrane domains and substrate-binding pockets can identify critical amino acids for substrate specificity .

  • Structural Modeling and Docking: Computational approaches using the established amino acid sequence of ABCG13 to predict protein structure and perform virtual docking with potential substrates .

  • Lipidomic Analysis of Substrate Pools: Comprehensive analysis of lipid compositions in different cellular compartments of flower cells can identify the specific substrates that accumulate in abcg13 mutants.

The complete amino acid sequence of ABCG13 (provided in the search results) serves as the foundation for these structure-function analyses, allowing researchers to target specific domains for manipulation .

How can advanced imaging techniques enhance the study of ABCG13 localization and dynamics?

Advanced imaging techniques offer powerful approaches to study ABCG13 localization, trafficking, and dynamics in planta:

  • Fluorescent Protein Fusions: Generation of ABCG13-GFP/YFP/mCherry fusion constructs under native or inducible promoters allows visualization of protein localization in living cells.

  • Super-Resolution Microscopy: Techniques such as Structured Illumination Microscopy (SIM), Stimulated Emission Depletion (STED), or Photoactivated Localization Microscopy (PALM) can resolve ABCG13 localization beyond the diffraction limit, potentially revealing subdomains within the plasma membrane.

  • Fluorescence Recovery After Photobleaching (FRAP): This technique can measure the mobility and turnover rates of ABCG13 in the membrane, providing insights into its dynamic behavior.

  • Proximity Ligation Assays (PLA): These can detect protein-protein interactions between ABCG13 and other components of the cuticle synthesis pathway in native tissue contexts.

  • Correlative Light and Electron Microscopy (CLEM): This approach combines fluorescence imaging of tagged ABCG13 with high-resolution ultrastructural analysis, allowing precise localization relative to cellular structures.

These techniques could reveal important information about the spatial and temporal regulation of ABCG13 during flower development and cuticle formation.

What are the best practices for quantifying cuticular lipids in abcg13 mutant studies?

Accurate quantification of cuticular lipids in abcg13 mutant studies requires careful methodological considerations:

  • Tissue-Specific Sampling: Given ABCG13's flower-specific function, precise sampling of floral tissues (particularly petals and carpels) at defined developmental stages is critical .

  • Extraction Protocols:

    • For total cuticular lipids: Chloroform immersion of intact tissues

    • For wax-specific analysis: Brief hexane or chloroform dips

    • For cutin monomers: Delipidation followed by depolymerization with BF3/methanol or sodium methoxide

  • Analytical Techniques:

    • Gas Chromatography-Mass Spectrometry (GC-MS) for identification and quantification of individual lipid species

    • Thin Layer Chromatography (TLC) for initial separation of lipid classes

    • Liquid Chromatography-Mass Spectrometry (LC-MS) for analysis of more complex or thermally labile compounds

  • Internal Standards: Addition of appropriate internal standards (e.g., heptadecanoic acid for fatty acids) is essential for accurate quantification .

  • Statistical Analysis: Proper replication (minimum n=3-5 biological replicates) and appropriate statistical tests are necessary, with data normalization typically performed relative to tissue surface area or dry weight.

These approaches have revealed that abcg13 mutants exhibit significant reductions in specific flower cutin monomers while maintaining relatively normal wax profiles, pointing to a selective role in cutin precursor transport .

How can researchers effectively design experiments to distinguish between direct and indirect effects of ABCG13 disruption?

Distinguishing direct from indirect effects of ABCG13 disruption requires carefully designed experimental approaches:

  • Temporal Expression Control: Using inducible promoter systems (e.g., estradiol or dexamethasone-inducible) to control when ABCG13 function is disrupted can help separate primary from secondary effects.

  • Cell-Type Specific Complementation: Restoring ABCG13 expression under cell-type specific promoters in the knockout background can determine where ABCG13 function is required for normal phenotype.

  • In vitro Transport Assays: Reconstituting purified recombinant ABCG13 in liposomes to directly test transport activity for putative substrates provides evidence for direct functional roles .

  • Metabolic Flux Analysis: Using isotope-labeled precursors to track the movement of potential substrates in wild-type versus abcg13 mutant backgrounds can reveal direct transport functions.

  • Transcriptome and Proteome Analysis: Comparing early versus late changes in gene expression and protein levels following ABCG13 disruption can help distinguish direct responses from adaptive ones.

These approaches collectively can build a more comprehensive understanding of ABCG13's direct biochemical functions versus its indirect effects on flower development and morphology.

What bioassays can be used to assess ABCG13 transport activity?

Several bioassays can effectively assess the transport activity of ABCG13:

  • Liposome Reconstitution Assays: Purified recombinant ABCG13 protein can be reconstituted into liposomes with fluorescently labeled or radiolabeled substrates inside . Transport activity is measured by the appearance of the label outside the liposomes over time.

  • Xenopus Oocyte Expression System: ABCG13 cRNA can be injected into Xenopus oocytes, followed by measuring the uptake or efflux of labeled potential substrates.

  • Yeast Complementation Assays: Expression of ABCG13 in yeast strains deficient in related transporters can be used to test functional complementation.

  • ATPase Activity Assays: Since ABCG13 is an ATP-binding cassette transporter, measuring ATP hydrolysis rates in the presence of different potential substrates can indicate substrate-stimulated activity .

  • Fluorescence-Based Transport Assays: Using fluorescent lipid analogs and measuring their transport in proteoliposomes containing purified ABCG13.

These functional assays can be complemented by structural studies of the recombinant protein to correlate transport activity with specific structural features .

How conserved is ABCG13 function across different plant species?

The evolutionary conservation of ABCG13 across plant species provides important insights into its fundamental importance and potential functional diversification:

This evolutionary perspective helps contextualize the function of ABCG13 within the broader scope of plant adaptation and diversification of reproductive structures.

What is the relationship between ABCG13 and other lipid transporters in the plant secretory pathway?

ABCG13 operates within a complex network of lipid transporters in the plant secretory pathway:

  • Functional Overlap with Other ABC Transporters: While ABCG13 is most closely related to ABCG11 and ABCG12, there are numerous other ABC transporters potentially involved in lipid transport . Comparative functional studies using multiple knockout combinations can reveal redundancies and specificities.

  • Coordination with Non-ABC Lipid Transporters: Plants utilize various non-ABC transport mechanisms for lipid movement, including lipid transfer proteins (LTPs), GDSL-lipases, and vesicular transport pathways. The relationship between ABCG13 and these alternative transport systems remains to be fully elucidated.

  • Subcellular Localization Network: Determining the precise subcellular localization of ABCG13 relative to other components of the lipid secretion pathway can reveal functional relationships and potential hand-off points in lipid movement from synthesis to extracellular deposition.

  • Transcriptional Coordination: Analysis of co-expression networks can identify lipid biosynthetic and transport components that are coordinately regulated with ABCG13, suggesting functional relationships.

Understanding these relationships is crucial for developing a comprehensive model of plant cuticle formation and the specialized adaptations that occur in floral tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.