Recombinant Arabidopsis thaliana ABC transporter G family member 17 (ABCG17)

Shipped with Ice Packs
In Stock

Description

Functional Role in ABA Homeostasis

ABCG17, alongside its homolog ABCG18, regulates ABA distribution and metabolism under non-stress conditions :

  • ABA Import: Localized to plasma membranes of shoot mesophyll and stem cortex cells, ABCG17 facilitates ABA uptake into parenchyma cells, promoting conjugation to inactive ABA-glucosyl ester (ABA-GE) .

  • Stomatal Regulation: By sequestering ABA into storage forms, ABCG17 limits free ABA availability in guard cells, thereby reducing stomatal closure and transpiration .

  • Long-Distance Translocation: ABCG17 modulates ABA movement from shoots to roots, influencing lateral root development .

Gene Expression and Localization

  • Tissue Specificity: ABCG17 is primarily expressed in shoot mesophyll and stem cortex cells, with no detectable activity in vascular tissues .

  • Stress Response: Under abiotic stress (e.g., drought), ABCG17 transcription is suppressed, enhancing free ABA availability for stress responses .

Research Findings from Mutant Studies

Key insights from genetic studies include:

Table 1: Phenotypic Effects of ABCG17 Manipulation

ExperimentObservationCitation
ABCG17 overexpressionReduced stomatal aperture, elevated leaf temperature, induced ABA signaling
abcg17/abcg18 double knockdownIncreased shoot ABA, reduced ABA-GE, enhanced water-use efficiency
ABA-GE accumulationABCG17 activity correlates with UDP-glycosyltransferase (UGT)-mediated ABA inactivation

Recombinant Production and Applications

The recombinant ABCG17 protein is critical for:

  • In vitro studies: Investigating ABA transport mechanisms and kinetics .

  • Structural analysis: Mapping ATP-binding and substrate-interaction domains .

  • Agricultural biotechnology: Engineering crops with optimized ABA responses for drought resistance .

Future Directions

Current research gaps include:

  • Elucidating ABCG17’s role in ABA-GE subcellular trafficking.

  • Developing inhibitors/activators for precision agriculture.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ABCG17; WBC17; At3g55100; T15C9.100; ABC transporter G family member 17; ABC transporter ABCG.17; AtABCG17; Probable white-brown complex homolog protein 17; AtWBC17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-662
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ABCG17
Target Protein Sequence
MLQRDAVIDVDESEIPPIPFVLAFNDLTYNVTLQQRFGLRFGHSPAKIKTLLNGITGEAK EGEILAILGASGAGKSTLIDALAGQIAEGSLKGTVTLNGEALQSRLLRVISAYVMQEDLL FPMLTVEETLMFAAEFRLPRSLSKSKKRNRVETLIDQLGLTTVKNTVIGDEGHRGVSGGE RRRVSIGTDIIHDPIVLFLDEPTSGLDSTSAFMVVQVLKKIARSGSIVIMSIHQPSGRIM EFLDRVIVLSSGQIVFSDSPATLPLFFSEFGSPIPEKENIAEFTLDLIKDLEGSPEGTRG LVEFNRNWQHRKLRVSQEPHHNSSSLGEAINASISRGKLVSTSYRSIPSYVNPWWVETVI LAKRYMINWTRTPELIGTRVFIVMMTGFLLATVYWKVDDSPRGVQERLSFFSFAMATMFY SCADGLPAFIQERYIFLRETAHNAYRRSSYVISHSLVTLPHLFALSIGFAATTFWFVGLN GGLAGFIYYLMIIFASFWSGCSFVTFVSGVIPNVMMSYMVTFGYLSYCLLFSGFYVNRDR IHLYWIWIHYISLLKYPYEAVLHNEFDDPSRCFVRGNQVFDNTIMEGVSETTKAKLLETM SGYLGMELTESTCLTTGSDLLKQHGIEQLDKWGCLWVTLAWGFFFRILFYFSLLLGSKNK RA
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G55100

STRING: 3702.AT3G55100.1

UniGene: At.1289

Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.