Recombinant Arabidopsis thaliana ABC transporter G family member 21 (ABCG21)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Plant Physiology

ABCG21 is implicated in critical physiological processes:

  • Stomatal Regulation: Localizes to guard cell membranes and interacts with AtABCG22 to modulate stomatal aperture. Double mutants (atabcg21 atabcg22) exhibit enhanced water loss and drought sensitivity compared to single mutants .

  • Pathogen Response: Part of the ABCG subfamily involved in exporting antimicrobial compounds or signaling molecules during biotic stress .

  • Lipid Transport: May contribute to cuticular lipid export, a role shared with ABCG11 and ABCG12 .

Subcellular Localization

Confocal imaging of GFP-tagged ABCG21 in Arabidopsis protoplasts and root cells confirmed plasma membrane localization, consistent with its role in transmembrane transport .

Genetic and Phenotypic Analysis

  • Single Mutants (atabcg21): Show mild stomatal dysfunction but no overt developmental defects .

  • Double Mutants (atabcg21 atabcg22): Exhibit synergistic phenotypes, including severe wilting under drought and altered ABA sensitivity .

Phenotypeatabcg21atabcg22atabcg21 atabcg22
Stomatal conductanceSlight ↑Moderate ↑Severe ↑
Drought susceptibilityMildModerateSevere
ABA responseNormalAlteredEnhanced impairment

Biochemical Challenges

Heterologous expression in Pichia pastoris revealed technical hurdles in cloning and membrane targeting, unlike the more tractable White Brown Complex 1 (WBC1) .

Applications and Future Directions

  • Agricultural Biotechnology: Targeting ABCG21 could enhance drought tolerance by optimizing stomatal density or closure .

  • Drug Transport Studies: Serves as a model for plant efflux transporters relevant to phytochemical engineering .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ABCG21; WBC21; At3g25620; T5M7.6; ABC transporter G family member 21; ABC transporter ABCG.21; AtABCG21; White-brown complex homolog protein 21; AtWBC21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-672
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ABCG21
Target Protein Sequence
MMPPNEQESSFPKTPSANRHETSPVQENRFSSPSHVNPCLDDDNDHDGPSHQSRQSSVLR QSLRPIILKFEELTYSIKSQTGKGSYWFGSQEPKPNRLVLKCVSGIVKPGELLAMLGPSG SGKTTLVTALAGRLQGKLSGTVSYNGEPFTSSVKRKTGFVTQDDVLYPHLTVMETLTYTA LLRLPKELTRKEKLEQVEMVVSDLGLTRCCNSVIGGGLIRGISGGERKRVSIGQEMLVNP SLLLLDEPTSGLDSTTAARIVATLRSLARGGRTVVTTIHQPSSRLYRMFDKVLVLSEGCP IYSGDSGRVMEYFGSIGYQPGSSFVNPADFVLDLANGITSDTKQYDQIETNGRLDRLEEQ NSVKQSLISSYKKNLYPPLKEEVSRTFPQDQTNARLRKKAITNRWPTSWWMQFSVLLKRG LKERSHESFSGLRIFMVMSVSLLSGLLWWHSRVAHLQDQVGLLFFFSIFWGFFPLFNAIF TFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLKPSLTTFI MTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIPGFIAWLK YVSFSHYCYKLLVGVQYTWDEVYECGSGLHCSVMDYEGIKNLRIGNMMWDVLALAVMLLL YRVLAYLALRNL
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G25620

STRING: 3702.AT3G25620.2

UniGene: At.28290

Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is ABCG21 and where is it primarily expressed in Arabidopsis thaliana?

ABCG21 is a half-size ABC transporter belonging to the G subfamily of ATP-binding cassette transporters in Arabidopsis thaliana. Gene expression analysis using the pAtABCG21::GUS reporter system has revealed that ABCG21 is specifically expressed in guard cells of seedlings and adult plants, but not in roots. This expression pattern is similar to that of AtABCG22, suggesting both transporters have guard cell-specific functions. When examining transgenic plants containing the pAtABCG21::GUS construct, GUS activity was detected primarily in guard cells in both seedlings and adult plants, with staining visible on the leaf surface in adult plants upon magnification . This cell-specific expression pattern provides strong evidence for ABCG21's role in stomatal regulation and water conservation mechanisms.

What is the subcellular localization of ABCG21 protein and how has it been determined?

ABCG21 is localized to the cell membrane in plant cells. This subcellular localization has been determined through two complementary approaches:

  • Transient expression of GFP-ABCG21 fusion protein in Arabidopsis protoplasts: When the 35S::GFP-AtABCG21 recombinant gene was expressed transiently in Arabidopsis protoplasts, confocal imaging revealed green fluorescence distinctly present around the cell surface.

  • Stable transformation with 35S::GFP-AtABCG21: Transgenic Arabidopsis plants expressing the GFP-AtABCG21 fusion protein showed clear fluorescence around the cell surface, particularly in root cells.

Both approaches consistently demonstrated membrane localization, which is consistent with ABCG21's proposed function as a transporter involved in moving substances across cellular membranes . This membrane localization is similar to that of ABCG22, supporting their potential functional relationship in guard cells.

How does ABCG21 contribute to stomatal regulation in Arabidopsis?

ABCG21 plays a significant role in stomatal regulation in Arabidopsis, functioning in close relationship with AtABCG22. Research has shown that ABCG21 is specifically expressed in guard cells, which are specialized cells controlling stomatal opening and closure. The atabcg21 mutation was found to suppress the open-stomata (OST) phenotype of atabcg22 mutants, suggesting a functional interaction between these two transporters in regulating stomatal aperture .

This suppression is specific to the atabcg22 mutant, as the atabcg21 mutation did not suppress the phenotypes of other open-stomata mutants such as srk2e (involved in ABA signaling) or nced3 (involved in ABA biosynthesis). This specificity indicates that ABCG21 and ABCG22 likely work together in a distinct pathway or mechanism regulating stomatal function, rather than being generally involved in ABA-mediated stomatal responses .

The precise mechanism by which ABCG21 influences stomatal aperture is still being investigated, but its membrane localization suggests it may transport specific substrates (possibly water, ions, or signaling molecules) that affect guard cell turgor and stomatal movement.

What is the functional relationship between ABCG21 and ABCG22, and how do they interact in water retention mechanisms?

ABCG21 and ABCG22 appear to have a close functional relationship in water retention mechanisms in Arabidopsis, with evidence suggesting they may work antagonistically:

  • Expression patterns: Both transporters are specifically expressed in guard cells, suggesting coordinated or related functions in stomatal regulation.

  • Phenotypic interactions: The atabcg22 single mutant exhibits an open-stomata (OST) phenotype, leading to increased water transpiration and drought susceptibility. Interestingly, the atabcg21 mutation suppresses this OST phenotype in atabcg21/atabcg22 double mutants, indicating that ABCG21 may counteract ABCG22's function in stomatal regulation .

  • Specificity of interaction: The atabcg21 mutation specifically suppresses the phenotype of atabcg22 but not other OST-type mutants (srk2e and nced3), suggesting a direct functional relationship between these two transporters rather than a general effect on stomatal regulation pathways .

  • Relation to ABA: While ABCG22 has been linked to ABA function, research shows enhanced phenotypes of atabcg22 mutants with additive effects to ABA signaling or biosynthesis, suggesting these transporters may function in parallel or complementary pathways to ABA-mediated responses.

This functional relationship indicates that ABCG21 and ABCG22 may form part of a balanced regulatory system controlling stomatal aperture and thus water retention in plants, with ABCG21 potentially promoting stomatal opening and ABCG22 contributing to stomatal closure.

What are the optimal conditions for expressing and purifying recombinant ABCG21 protein?

For optimal expression and purification of recombinant ABCG21 protein, the following protocol is recommended based on established methods:

Expression System:

  • Host: E. coli is the preferred expression system

  • Vector: Expression vector containing an N-terminal His tag for purification

  • Full-length construct: Including amino acids 1-672 of ABCG21 (Q7XA72)

Purification Protocol:

  • Express the protein in E. coli under appropriate induction conditions

  • Harvest cells and lyse using appropriate buffer systems

  • Purify using affinity chromatography (His-tag based)

  • Elute and lyophilize to obtain protein as a lyophilized powder

Storage Recommendations:

  • Store at -20°C/-80°C upon receipt

  • Aliquot for multiple uses to avoid repeated freeze-thaw cycles

  • Use Tris/PBS-based buffer with 6% Trehalose, pH 8.0 as storage buffer

Reconstitution Protocol:

  • Briefly centrifuge vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (recommended final concentration 50%) for long-term storage at -20°C/-80°C

Quality Control:

  • Verify purity >90% using SDS-PAGE

  • For working aliquots, store at 4°C for up to one week

  • Avoid repeated freezing and thawing

These conditions help maintain protein stability and functionality for downstream applications such as structural studies, binding assays, or transport activity measurements.

How can researchers effectively analyze ABCG21 expression patterns in different tissues?

Researchers can employ several complementary techniques to effectively analyze ABCG21 expression patterns across different tissues:

1. Promoter-Reporter Fusion Analysis:

  • Generate transgenic plants containing pAtABCG21::GUS constructs (using ~2 kb of the ABCG21 promoter region)

  • Perform histochemical GUS staining of different tissues and developmental stages

  • Analyze under microscopy to determine cell-specific expression patterns

  • This approach has successfully demonstrated guard cell-specific expression of ABCG21

2. Quantitative RT-PCR:

  • Design gene-specific primers for ABCG21

  • Isolate RNA from different tissues (leaves, roots, stems, flowers, guard cell-enriched preparations)

  • Perform qRT-PCR with appropriate reference genes

  • Analyze relative expression levels across tissues

3. In situ Hybridization:

  • Generate gene-specific RNA probes for ABCG21

  • Perform in situ hybridization on tissue sections

  • This provides spatial resolution of expression at the cellular level

4. Fluorescent Protein Fusion:

  • Create ABCG21 promoter-driven fluorescent protein constructs (GFP, YFP)

  • Generate stable transgenic lines

  • Analyze expression patterns using confocal microscopy

  • This approach also allows visualization of subcellular localization

5. Single-cell RNA Sequencing:

  • For advanced expression analysis, perform scRNA-seq on different cell types

  • This provides high-resolution expression data at single-cell level

  • Particularly useful for comparing expression between guard cells and other cell types

A comprehensive approach combining multiple techniques provides the most reliable assessment of expression patterns. For guard cell-specific studies, epidermal peels or guard cell protoplast isolation methods can be employed to enrich for these specialized cells before analysis .

How does genetic variation in ABCG21 affect stomatal response and drought tolerance?

Genetic variation in ABCG21 has significant implications for stomatal response and drought tolerance in Arabidopsis, making it an important target for crop improvement research:

Research Findings on ABCG21 Genetic Variation:

  • Knockout phenotypes: Complete loss-of-function mutations in ABCG21 (atabcg21) have been shown to suppress the open-stomata phenotype of atabcg22 mutants, suggesting that natural variants with altered ABCG21 function might exhibit modified stomatal regulation and water use efficiency .

  • Interaction with ABCG22: The atabcg21 mutation specifically suppresses the atabcg22 phenotype but not other open-stomata mutants (such as srk2e and nced3), indicating a unique genetic interaction pathway . Natural variation in this interaction could lead to diverse drought response phenotypes.

  • Potential SNP effects: While specific SNPs in ABCG21 haven't been extensively characterized in the provided search results, research on other ABC transporters like ABCG2 has shown that single nucleotide polymorphisms (e.g., c.421C>A in ABCG2) can significantly affect transporter function . Similar variations might exist in ABCG21 and influence its activity.

Methodological Approaches for Studying ABCG21 Variation:

  • CRISPR-Cas9 gene editing: Create precise mutations in ABCG21 to study how specific amino acid changes affect protein function and plant phenotype

  • Natural variation studies: Screen diverse Arabidopsis ecotypes for ABCG21 sequence variation and correlate with stomatal behavior and drought tolerance

  • Genetic interaction mapping: Perform genetic crosses between plants with different ABCG21 alleles and known stomatal regulation mutants to identify epistatic relationships

  • Complementation analysis: Express different ABCG21 variants in atabcg21 knockout background to assess functional consequences of specific variations

  • Field trials: Evaluate plants with different ABCG21 variants under controlled drought conditions to assess real-world implications of genetic variation

Understanding the relationship between ABCG21 genetic variation and drought tolerance could provide valuable insights for breeding more water-efficient crop varieties, especially in the context of climate change and increasing water scarcity.

What are the potential substrates transported by ABCG21 and how can they be identified?

Identifying the substrates transported by ABCG21 represents a significant research challenge but is crucial for understanding its precise role in stomatal regulation. Here are methodological approaches researchers can employ to identify ABCG21 substrates:

Potential Substrate Candidates:
Based on the function of ABCG21 in stomatal regulation and its relationship with ABCG22, potential substrates might include:

  • Plant hormones (particularly ABA or its metabolites)

  • Signaling lipids or lipid derivatives

  • Ions involved in guard cell turgor regulation

  • Secondary metabolites affecting guard cell function

  • Water molecules (although direct water transport is less likely)

Methodological Approaches for Substrate Identification:

  • Transport Assays with Vesicles/Proteoliposomes:

    • Express and purify recombinant ABCG21 protein

    • Reconstitute in liposomes or membrane vesicles

    • Perform transport assays with radiolabeled or fluorescently labeled candidate substrates

    • Measure substrate accumulation inside vesicles using appropriate detection methods

  • Heterologous Expression Systems:

    • Express ABCG21 in yeast, Xenopus oocytes, or mammalian cell lines

    • Perform uptake/efflux assays with candidate substrates

    • Use controls including ATP-binding site mutants to confirm ATP-dependent transport

  • Metabolomics Analysis:

    • Compare metabolite profiles between wild-type, atabcg21 mutants, and ABCG21-overexpressing plants

    • Focus on guard cell-enriched samples to identify differentially abundant metabolites

    • Validate candidate substrates with direct transport assays

  • Guard Cell Patch-Clamp Analysis:

    • Perform electrophysiological measurements on guard cells from wild-type and atabcg21 plants

    • Test responses to potential substrates and inhibitors

    • Correlate with stomatal aperture measurements

  • Substrate Competition Assays:

    • If one substrate is identified, use it as a reference to test competition with other potential substrates

    • This approach can help identify families of transported compounds

  • Structural Modeling and Docking:

    • Generate structural models of ABCG21 based on crystal structures of related transporters

    • Perform in silico docking studies with potential substrates

    • Use these predictions to guide experimental approaches

Identifying ABCG21 substrates would significantly advance our understanding of the molecular mechanisms underlying stomatal regulation and could provide novel targets for improving plant water use efficiency and drought tolerance.

How does the functional relationship between ABCG21 and ABCG22 compare to other ABC transporter interactions in plants?

The functional relationship between ABCG21 and ABCG22 represents an interesting case of interaction between ABC transporters that may provide insights into how these proteins function cooperatively in plant systems:

ABCG21-ABCG22 Interaction Characteristics:

  • Opposing functional effects: ABCG21 appears to counteract ABCG22 function, as the atabcg21 mutation suppresses the open-stomata phenotype of atabcg22 mutants .

  • Co-expression in the same cell type: Both transporters are specifically expressed in guard cells, suggesting they may form part of a coordinated transport system .

  • Specificity of interaction: The atabcg21 mutation specifically suppresses atabcg22 phenotypes but not other open-stomata mutants, indicating a direct functional relationship rather than general effects on stomatal pathways .

Comparison with Other Plant ABC Transporter Interactions:

ABC Transporter PairCell TypeFunctionInteraction TypeReference
ABCG21-ABCG22Guard cellsStomatal regulationOpposing/antagonistic
ABCG9-ABCG31PollenPollen coat maturationCooperative
ABCG11-ABCG12EpidermisCuticular wax transportCooperative
ABCG11-ABCG13EpidermisCutin precursor transportCooperative
ABCB1-ABCG2Blood-brain barrierDrug transportFunctional redundancy

Research has shown that many ABC transporters work cooperatively to transport substrates, as seen with AtABCG9 and AtABCG31 in pollen coat maturation, or AtABCG11, AtABCG12, and AtABCG13 in cuticular wax and cutin transport . In contrast, the ABCG21-ABCG22 relationship appears to involve opposing functions.

In mammalian systems, a different type of interaction is observed between ABCB1 and ABCG2 at the blood-brain barrier, where they exhibit functional redundancy in limiting drug distribution . This redundancy can be compromised in carriers of genetic variants like the c.421C>A SNP in ABCG2 .

The antagonistic relationship between ABCG21 and ABCG22 represents a less common mode of interaction among ABC transporters and warrants further investigation to understand the molecular basis of this functional opposition. This could involve:

  • Different substrate specificities with opposing effects on stomatal regulation

  • Competition for the same substrate but with different directional transport

  • Regulation of each other's expression or activity

  • Formation of heterodimers with altered transport properties

Understanding this antagonistic relationship may provide insights into the evolution of complex transport systems in plants and offer new strategies for modulating stomatal behavior in crops.

What challenges are associated with studying ABCG21 function in planta and how can they be addressed?

Studying ABCG21 function in planta presents several technical challenges that researchers must navigate. Here are the key challenges and methodological approaches to address them:

1. Functional Redundancy with Other Transporters:

  • Challenge: ABCG21 may have overlapping functions with other ABC transporters, masking phenotypes in single mutants.

  • Solution: Generate higher-order mutants (e.g., atabcg21/atabcg22 double mutants) and analyze phenotypic differences from single mutants . Consider CRISPR/Cas9 approaches for creating multiplex mutations in related transporters.

2. Guard Cell-Specific Expression:

  • Challenge: Guard cells comprise only a small fraction of total leaf tissue, making biochemical analyses difficult.

  • Solution: Use guard cell-specific promoters for expressing tagged versions of ABCG21, employ guard cell isolation techniques (enzymatic digestion or mechanical isolation), and utilize single-cell or cell type-specific transcriptomics approaches.

3. Membrane Protein Analysis:

  • Challenge: As a membrane protein, ABCG21 is difficult to solubilize and maintain in its native conformation.

  • Solution: Optimize extraction conditions using appropriate detergents, consider native membrane preparations, and use specialized techniques like microscale thermophoresis for binding studies.

4. Phenotypic Analysis of Stomatal Function:

  • Challenge: Stomatal responses can be subtle and affected by multiple environmental factors.

  • Solution: Employ multiple complementary approaches:

    • Thermal imaging for leaf temperature measurements

    • Gas exchange analysis for transpiration rates

    • Direct stomatal aperture measurements using microscopy

    • Water loss assays from detached leaves

    • Long-term water use efficiency assessments

5. Substrate Identification:

  • Challenge: Identifying transported substrates is difficult without prior knowledge.

  • Solution: Combine targeted approaches (testing known molecules involved in guard cell function) with untargeted metabolomics comparing wild-type and mutant guard cells.

6. Temporal Regulation:

  • Challenge: ABCG21 function may vary depending on time of day or developmental stage.

  • Solution: Conduct time-course experiments and analyze ABCG21 function across different developmental stages and diurnal cycles.

7. Environmental Response Variations:

  • Challenge: ABCG21 function may depend on specific environmental conditions.

  • Solution: Test multiple environmental scenarios (drought, humidity, temperature, CO2 levels) and analyze how ABCG21 function changes under different stresses.

By addressing these challenges with appropriate methodological approaches, researchers can gain deeper insights into ABCG21 function and its role in stomatal regulation and plant water use efficiency.

How can researchers effectively distinguish between the functions of ABCG21 and other ABC transporters in Arabidopsis?

Distinguishing between the functions of ABCG21 and other ABC transporters in Arabidopsis requires a multi-faceted approach combining genetic, biochemical, and physiological techniques. Here are methodological strategies to effectively differentiate their functions:

1. Genetic Approaches:

  • Higher-order mutant analysis: Create and characterize single, double, and higher-order mutants of ABCG21 with closely related transporters (especially ABCG22). The atabcg21/atabcg22 double mutant analysis has already revealed specific interactions between these transporters .

  • Complementation studies: Express ABCG21 in different ABC transporter mutant backgrounds to test for functional complementation. If ABCG21 can rescue the phenotype of another transporter mutant, it suggests functional overlap.

  • Domain-swapping experiments: Create chimeric proteins between ABCG21 and other ABC transporters to identify domains responsible for specific functions and substrate specificities.

2. Expression Pattern Analysis:

  • Cell type-specific expression: Compare expression patterns using promoter-reporter fusions (e.g., pABCG21::GUS). ABCG21 shows guard cell-specific expression similar to ABCG22, but different from other ABC transporters that may be expressed in epidermis, pollen, or other tissues .

  • Single-cell RNA-seq: Perform single-cell transcriptomics to create high-resolution expression maps of multiple ABC transporters across different cell types.

  • Temporal expression patterns: Analyze expression under different conditions and time points to identify unique regulation patterns.

3. Biochemical and Substrate Specificity:

  • In vitro transport assays: Express and purify different ABC transporters and test their substrate preferences in reconstituted systems.

  • Competition assays: If a substrate for one transporter is known, test whether it inhibits ABCG21-mediated transport.

  • Comparative metabolomics: Analyze metabolite profiles in various ABC transporter mutants to identify transporter-specific substrate candidates.

4. Structural Biology Approaches:

  • Protein modeling and docking: Generate structural models of different ABC transporters and compare their substrate-binding pockets and transport mechanisms.

  • Cryo-EM or X-ray crystallography: Determine the actual structures of these transporters to identify structural differences that explain functional specificity.

5. Phenotypic Analysis Under Different Conditions:

  • Stress-specific responses: Compare phenotypes of different ABC transporter mutants under various stresses (drought, salt, pathogens) to identify condition-specific functions.

  • Developmental timing: Analyze phenotypes at different developmental stages to identify stage-specific functions.

6. Physiological Measurements:

  • Guard cell function: For ABCG21 and ABCG22, compare effects on:

    • Stomatal aperture measurements

    • Stomatal conductance

    • Leaf temperature (using thermal imaging)

    • Water loss rates

    • ABA sensitivity

This comprehensive approach allows researchers to effectively distinguish between the functions of ABCG21 and other ABC transporters, revealing both their unique roles and potential functional overlaps in plant physiology.

How can understanding ABCG21 function contribute to crop improvement strategies for drought tolerance?

Understanding ABCG21 function offers significant potential for developing crop improvement strategies focused on enhanced drought tolerance. Here's how this knowledge can be translated into practical applications:

Mechanistic Insights and Potential Applications:

  • Stomatal Regulation Enhancement:
    Research has demonstrated that ABCG21 plays a role in stomatal regulation, with the atabcg21 mutation suppressing the open-stomata phenotype of atabcg22 mutants . This suggests that modulating ABCG21 expression or activity could help control water loss through stomata, potentially improving water use efficiency in crops.

  • Genetic Engineering Approaches:

    • CRISPR/Cas9-mediated modification of ABCG21 orthologs in crops

    • Overexpression or suppression of ABCG21, depending on its role in specific crop species

    • Creation of modified versions with altered transport properties or regulation

    • Engineering of the ABCG21-ABCG22 balance to optimize stomatal responses

  • Marker-Assisted Selection:
    Natural variation in ABCG21 could be leveraged to identify beneficial alleles associated with improved drought performance. These alleles could then be incorporated into breeding programs through marker-assisted selection.

  • Stress-Responsive Promoters:
    Placing ABCG21 under the control of stress-responsive promoters could allow for dynamic regulation of its expression during drought conditions, potentially enhancing plant responses to water limitation.

Comparative Studies Across Species:

SpeciesABCG21 Homolog StatusPotential ApplicationExpected Outcome
Rice (Oryza sativa)Identify and characterizeModerate expression to balance water conservation and photosynthesisImproved water use efficiency while maintaining yield
Wheat (Triticum aestivum)Identify and characterizeEngineer for faster stomatal responseEnhanced adaptation to fluctuating water availability
Maize (Zea mays)Identify and characterizeOptimize for C4 photosynthesis contextBalanced water use and carbon assimilation
Soybean (Glycine max)Identify and characterizeTarget for altered expression in drought-prone regionsStabilized yield under water limitation

Implementation Considerations:

  • Context-Dependent Optimization:
    The optimal modulation of ABCG21 would likely differ based on:

    • Crop species and photosynthetic pathway (C3 vs. C4)

    • Target environment and climate

    • Irrigation availability

    • Growth stage-specific water requirements

  • Integration with Other Drought Tolerance Traits:
    ABCG21 modifications should be integrated with other drought tolerance strategies, such as:

    • Root architecture improvements

    • Osmotic adjustment capabilities

    • Heat tolerance (as drought often coincides with heat stress)

    • ABA sensitivity optimization

  • Field Validation Protocol:

    • Controlled environment testing under defined water limitation

    • Multi-location field trials across moisture gradients

    • Assessment of yield stability across seasons

    • Evaluation of potential trade-offs with other agronomic traits

By translating fundamental knowledge about ABCG21 function in Arabidopsis to crop improvement strategies, researchers can potentially develop more drought-resilient varieties that maintain productivity under water-limited conditions, addressing a critical need in the face of climate change.

What methodological approaches can be used to study ABCG21 orthologs in crop species?

Studying ABCG21 orthologs in crop species requires adapting and extending methodologies beyond those used in the model plant Arabidopsis. Here are comprehensive approaches for investigating ABCG21 orthologs in crops:

1. Identification and Characterization of ABCG21 Orthologs:

  • Bioinformatic identification:

    • Perform sequence similarity searches using Arabidopsis ABCG21 as query

    • Conduct phylogenetic analyses to confirm orthology relationships

    • Analyze synteny to identify true orthologs versus paralogs

    • Examine gene structure and regulatory elements

  • Expression analysis:

    • RNA-seq of different tissues, developmental stages, and stress conditions

    • RT-qPCR validation of expression patterns

    • Promoter-reporter studies (e.g., promoter-GUS/GFP) to determine tissue specificity

    • In situ hybridization for high-resolution spatial expression analysis

2. Functional Characterization:

  • Reverse genetic approaches:

    • CRISPR/Cas9 gene editing to generate knockout or knockdown lines

    • TILLING (Targeting Induced Local Lesions IN Genomes) in species where transformation is challenging

    • RNAi or virus-induced gene silencing for transient functional studies

    • Overexpression studies using constitutive or tissue-specific promoters

  • Phenotypic analyses:

    • Stomatal conductance measurements using porometry or gas exchange systems

    • Thermal imaging to assess leaf temperature as proxy for transpiration

    • Water use efficiency determination (biomass produced per water consumed)

    • Drought survival and recovery assessments

    • Yield stability under water-limited conditions

3. Protein-Level Studies:

  • Subcellular localization:

    • Fluorescent protein fusions to determine cellular localization

    • Immunolocalization with specific antibodies

    • Membrane fractionation followed by western blotting

  • Transport activity:

    • Heterologous expression in yeast, Xenopus oocytes, or insect cells

    • Reconstitution in proteoliposomes for transport assays

    • Patch-clamp electrophysiology of guard cells

4. Natural Variation Studies:

  • Allele mining:

    • Sequence ABCG21 orthologs across diverse germplasm collections

    • Identify haplotypes and correlate with drought response phenotypes

    • Develop functional markers for beneficial alleles

  • Association genetics:

    • Perform genome-wide association studies (GWAS) focusing on drought tolerance traits

    • Evaluate whether ABCG21 loci are associated with water use efficiency

5. Comparative Studies Across Multiple Crops:

Methodological ApproachRiceWheatMaizeSoybean
Transformation methodAgrobacterium-mediatedParticle bombardment or AgrobacteriumAgrobacterium-mediatedAgrobacterium-mediated
Genome editing efficiencyHighModerate (hexaploid challenge)HighHigh
Tissue culture requirementsModerateHighModerateModerate
Available mutant resourcesExtensiveGrowingExtensiveGrowing
Field phenotyping considerationsPaddy vs. upland systemsVarious moisture regimesMultiple stress combinationsGrowth stage-specific analysis

6. Translational Research Pipeline:

  • Identify and characterize crop ABCG21 orthologs

  • Generate genetic modification lines (knockouts, overexpression)

  • Phenotype under controlled conditions

  • Test promising lines in field trials under various water regimes

  • Integrate beneficial alleles or transgenic events into breeding programs

  • Assess yield stability and agronomic performance

  • Evaluate potential environmental impacts and regulatory considerations

This comprehensive methodological framework enables researchers to effectively study ABCG21 orthologs in crop species, providing crucial information for translating fundamental knowledge from Arabidopsis into practical crop improvement strategies for enhanced drought tolerance.

What are the most significant unresolved questions about ABCG21 function and regulation?

Despite significant progress in understanding ABCG21, several crucial questions remain unresolved. These knowledge gaps represent important opportunities for future research:

  • Substrate Specificity and Transport Mechanism:

    • What specific molecules does ABCG21 transport across membranes?

    • Does it function as an importer, exporter, or bidirectional transporter?

    • How does ATP hydrolysis couple to the transport process in ABCG21?

    • Does ABCG21 require partner proteins or form heterodimers for function?

  • Functional Relationship with ABCG22:

    • What is the molecular basis for the antagonistic relationship between ABCG21 and ABCG22?

    • Do they transport the same substrates in opposite directions or different substrates with opposing effects?

    • Do they interact physically or only functionally?

    • How is the balance between their activities regulated under different conditions?

  • Regulatory Mechanisms:

    • How is ABCG21 expression regulated at transcriptional and post-transcriptional levels?

    • What signaling pathways control ABCG21 activity in response to environmental cues?

    • Are there post-translational modifications that regulate ABCG21 function?

    • Does ABCG21 undergo regulated trafficking to and from the plasma membrane?

  • Integration with Stomatal Signaling Networks:

    • How does ABCG21 interface with ABA signaling pathways?

    • What is the relationship between ABCG21 and ion channels in guard cells?

    • How does ABCG21 contribute to the kinetics of stomatal responses?

    • Does ABCG21 function change under different stress conditions?

  • Evolutionary Conservation and Diversity:

    • How conserved is ABCG21 function across different plant species?

    • Do crop plant orthologs show functional diversification related to specific adaptation strategies?

    • What can we learn from ABCG21 orthologs in drought-tolerant species?

These unresolved questions highlight the complexity of ABCG21 biology and the need for integrated approaches combining molecular, cellular, physiological, and evolutionary perspectives to fully understand its role in plant water relations.

What emerging technologies could advance our understanding of ABCG21 function?

Several cutting-edge technologies are poised to significantly advance our understanding of ABCG21 function, offering new insights into its molecular mechanisms and physiological roles:

1. Advanced Structural Biology Techniques:

  • Cryo-electron microscopy (cryo-EM): Enables visualization of ABCG21 structure in different conformational states without the need for crystallization

  • Single-particle analysis: Reveals dynamic structural changes during transport cycles

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifies regions of ABCG21 that undergo conformational changes upon substrate binding

  • AlphaFold2 and advanced AI structure prediction: Generates increasingly accurate structural models to guide experimental approaches

2. Advanced Imaging Technologies:

  • Super-resolution microscopy: Tracks ABCG21 localization and dynamics at nanoscale resolution

  • Live-cell FRET sensors: Monitors ABCG21 conformational changes or protein-protein interactions in real-time

  • Correlative light and electron microscopy (CLEM): Combines functional and structural imaging of ABCG21

  • Biosensors for potential substrates: Visualizes transport activity in vivo

3. Single-Cell and Spatial Technologies:

  • Single-cell RNA-seq of guard cells: Reveals population heterogeneity and transcriptional networks

  • Spatial transcriptomics: Maps gene expression patterns in intact leaf tissues

  • Single-cell proteomics: Identifies protein-level changes in individual guard cells

  • Patch-seq: Combines electrophysiology and transcriptomics from the same cell

4. Advanced Functional Genomics:

  • CRISPR base editing and prime editing: Creates precise mutations without double-strand breaks

  • CRISPR interference/activation (CRISPRi/CRISPRa): Modulates ABCG21 expression without genetic modification

  • CRISPR screens: Identifies genetic interactors of ABCG21

  • Synthetic biology approaches: Reconstructs minimal systems to study ABCG21 function

5. Advanced Metabolomics and Substrate Identification:

  • Activity-based protein profiling: Identifies interacting molecules

  • Metabolite flux analysis with stable isotopes: Tracks movement of potential substrates

  • Untargeted metabolomics with spatial resolution: Maps metabolite distributions in relation to ABCG21 expression

  • Nanoscale secondary ion mass spectrometry (NanoSIMS): Provides subcellular resolution of element and isotope distributions

6. High-throughput Phenotyping:

  • Automated microscopy of stomatal responses: Enables large-scale screening of stomatal dynamics

  • Hyperspectral imaging: Detects subtle phenotypic changes related to water content and stress

  • Field-based phenotyping with drones and sensors: Translates lab findings to real-world conditions

  • Machine learning analysis of complex phenotypic data: Identifies patterns not detectable by conventional methods

7. Systems Biology Integration:

  • Multi-omics data integration: Combines transcriptomics, proteomics, metabolomics, and phenomics

  • Network modeling: Places ABCG21 in the broader context of guard cell signaling

  • Predictive modeling of stomatal behavior: Incorporates ABCG21 function into physiological models

  • Digital twin approaches: Creates virtual plant models to predict responses to environmental changes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.