Recombinant Arabidopsis thaliana ABC transporter G family member 23 (ABCG23)

Shipped with Ice Packs
In Stock

Description

Recombinant Arabidopsis thaliana ABC Transporter G Family Member 23 (ABCG23): Overview

Recombinant Arabidopsis thaliana ABCG23 is a full-length ATP-binding cassette (ABC) transporter protein expressed in E. coli and purified for research purposes. It belongs to the ABCG subfamily, a large group of transporters critical for diverse plant processes, including suberin synthesis, pollen wall formation, and phytohormone transport .

ABCG Subfamily Roles

ProcessKey ABCG TransportersFunction
Suberin SynthesisABCG2, ABCG6, ABCG20Barrier formation in roots and seed coats
Pollen Wall IntegrityABCG1, ABCG16Male reproductive development
Phytohormone TransportABCG11, ABCG12Cuticle formation and auxin homeostasis
Pathogen DefenseABCG36 (PEN3)Efflux of antimicrobial compounds

Available Recombinant Products

Several recombinant ABCG23 proteins are commercially available:

Product IDSourcePurityHostTag
RFL25409AFArabidopsis>90%E. coliHis-tag
RFL31559DFDictyostelium>90%E. coliHis-tag

While these tools facilitate in vitro studies, ABCG23’s specific role remains understudied. Unlike ABCG2/6/20 (suberin) or ABCG1/16 (pollen), no direct functional data exists for ABCG23 in literature .

Challenges in Functional Characterization

  1. Substrate Ambiguity: Most ABCG transporters lack confirmed substrates due to methodological limitations .

  2. Pleiotropic Effects: Mutants often show overlapping phenotypes, complicating functional assignment .

  3. Dimerization Complexity: Half-size ABCG proteins require heterodimerization, which may alter substrate specificity .

Future Directions

  1. In Vitro Transport Assays: Required to identify ABCG23 substrates and transport directionality .

  2. Protein Interaction Studies: Identify dimerization partners using co-IP or yeast two-hybrid methods .

  3. CRISPR Mutant Analysis: Generate abcg23 knockouts to observe phenotypic effects in Arabidopsis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. If you have a specific format requirement, please indicate it in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchase method and location. For specific delivery times, please contact your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
ABCG23; WBC24; At5g19410; F7K24.160; ABC transporter G family member 23; ABC transporter ABCG.23; AtABCG23; Probable white-brown complex homolog protein 24; AtWBC24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-624
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ABCG23
Target Protein Sequence
MASCFHPSAMATSHREEDSIILFSASNSPDEFSSASSSFSSSPLPTPNRYSLTVTNLSYT INHTPILNSVSLAAESSKILAVVGPSGTGKSTLLKIISGRVNHKALDPSSAVLMNNRKIT DYNQLRRLCGFVPQDDDLLPLLTVKETLMYSAKFSLRDSTAKEREERVESLLSDLGLVLV QDSFVGEGDEEDRGVSGGERKRVSIAVEMIRDPPILLLDEPTSGLDSRNSLQVVELLATM AKSKQRTVLFSIHQPSYRILDYISDYLILSRGSVIHLGSLEHLEDSIAKLGFQIPEQLNP IEFAMEIVESLRTFKPNSVAVVESSSMWPENNENDGIISKKEAFRVLDVTEISYLCSRFC KIIYRTKQLFLARTMQAVVAGLGLGSVYTRLKRDEEGVAERLGLFAFSLSFLLSSTVEAL PIYLRERRVLMKESSRGSYRISSYMIANTIAFVPFLFVVSLLFSIPVYWIVGLNPSIQAF SFFVLCVWLIILMASSLVLFLSAVSPDFISGNSLICTVLGAFFLFSGYFIPKEKIPKPWM FMYYVSLYRYPLESMVVNEYWSMREECFSSGNMGCLMTGEDVLKERGLDKDTRWINVGIM LAFFVFYRILCWGILLRKASKSTH
Uniprot No.

Target Background

Database Links

KEGG: ath:AT5G19410

STRING: 3702.AT5G19410.1

UniGene: At.65531

Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is ABCG23 and where is it located in the Arabidopsis genome?

ABCG23 (also known as AtABCG23) is a member of the ATP-binding cassette (ABC) transporter G subfamily in Arabidopsis thaliana. It is alternatively named as the probable white-brown complex homolog protein 24 (AtWBC24). The gene is located on chromosome 5 at locus At5g19410 (ORF name: F7K24.160). ABC transporters are membrane-bound proteins that utilize the energy from ATP hydrolysis to transport various substrates across cellular membranes . In plants, the ABCG subfamily is particularly extensive compared to other eukaryotes and plays crucial roles in various physiological processes .

How does the ABCG subfamily function in Arabidopsis?

ABC transporters in the ABCG subfamily serve diverse functions in Arabidopsis, including:

  • Pathogen response and defense mechanisms

  • Formation of diffusion barriers (e.g., suberin, cutin, and wax)

  • Phytohormone transport and regulation

  • Pollen wall development

These transporters exhibit considerable functional diversity despite sequence similarities. The ABCG subfamily can be divided into half-size transporters (requiring dimerization to function) and full-size transporters. Their substrates often include lipophilic compounds, though the exact substrate specificity remains unknown for many members, including ABCG23 .

What methods should be used to study ABCG23 expression patterns?

To effectively investigate ABCG23 expression patterns, researchers should employ multiple complementary approaches:

Transcriptional analysis methods:

  • RT-qPCR: Design primers specific to ABCG23 (At5g19410) to quantify expression levels across tissues, developmental stages, and in response to various treatments.

  • Promoter-reporter constructs: Generate ABCG23 promoter:GUS or ABCG23 promoter:GFP fusion constructs to visualize spatial and temporal expression patterns in planta.

  • RNA-Seq: For genome-wide expression analysis that can place ABCG23 in broader co-expression networks.

Translation-level analysis:

  • Western blotting: Develop specific antibodies against ABCG23 or use epitope tagging approaches.

  • Translational fusions: Create ABCG23:GFP translational fusions under native promoter control to monitor protein localization and abundance.

Based on studies of related ABCG transporters, hormones like ABA may regulate ABCG23 expression. Tests should include hormone treatments (ABA, auxin, gibberellins), abiotic stresses (salt, drought, cold), and biotic challenges (pathogen exposure) . Similar to ABCG16, which is upregulated by ABA and bacterial infection, ABCG23 may show stress-responsive expression patterns .

How can I express and purify recombinant ABCG23 for functional studies?

Expression and purification protocol for recombinant ABCG23:

  • Expression system selection:

    • Bacterial systems: Use E. coli strains optimized for membrane protein expression (C41, C43, Lemo21)

    • Eukaryotic systems: Consider yeast (P. pastoris, S. cerevisiae), insect cells (Sf9, High Five), or plant cell cultures for proper folding and post-translational modifications

  • Vector design considerations:

    • Include affinity tags (His6, Strep-tag II, or FLAG) for purification

    • Add fluorescent tags (GFP) to monitor expression and localization

    • Consider fusion partners to enhance solubility (MBP, SUMO)

  • Solubilization optimization:

    • Test various detergents (DDM, LMNG, GDN) at different concentrations

    • Consider native nanodiscs or styrene maleic acid lipid particles (SMALPs) for membrane extraction

  • Purification strategy:

    • Implement two-step purification (e.g., IMAC followed by size exclusion chromatography)

    • Optimize buffer conditions (pH, salt, glycerol content)

    • Include stabilizing agents (cholesterol hemisuccinate, specific lipids)

  • Quality control assessments:

    • Size exclusion chromatography to verify monodispersity

    • Thermal stability assays to optimize buffer conditions

    • ATPase activity measurements to confirm functionality

For storage, maintain purified ABCG23 in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage. Avoid repeated freeze-thaw cycles and store working aliquots at 4°C for up to one week .

What techniques are most effective for determining ABCG23 substrate specificity?

Determining substrate specificity for ABCG transporters is challenging due to their diverse roles. For ABCG23, employ multiple complementary approaches:

In vitro transport assays:

  • Vesicle-based transport: Reconstitute purified ABCG23 into proteoliposomes and test transport of radiolabeled or fluorescently labeled candidate substrates.

  • ATPase activity stimulation: Measure enhanced ATPase activity in the presence of potential substrates.

  • Binding assays: Use microscale thermophoresis or surface plasmon resonance to detect direct interactions with candidate substrates.

Cellular transport systems:

  • Heterologous expression: Express ABCG23 in yeast mutants lacking endogenous transporters and test for complementation or substrate accumulation.

  • Membrane vesicles: Isolate inside-out or right-side-out membrane vesicles from cells expressing ABCG23 for transport assays.

In planta approaches:

  • Metabolic profiling: Compare metabolites in wild-type versus abcg23 mutant plants using LC-MS/MS or GC-MS.

  • Radiolabeled substrate feeding: Track the movement of potential substrates in wild-type versus mutant tissues.

  • Xenobiotic sensitivity tests: Examine differential tolerance to potential toxic substrates.

Based on knowledge of related ABCG transporters, candidate substrates may include:

  • Lipophilic compounds (cuticular waxes, suberin precursors)

  • Phytohormones (ABA, cytokinins, strigolactones)

  • Secondary metabolites involved in stress responses

  • Signaling molecules for pathogen response

What phenotypic analyses should be conducted on abcg23 mutant lines?

A comprehensive phenotypic analysis of abcg23 mutant lines should include:

Growth and developmental phenotypes:

  • Germination rate and timing under normal and stress conditions

  • Root system architecture (primary root length, lateral root number, root hair formation)

  • Shoot development (rosette size, leaf morphology, flowering time)

  • Reproductive development (flower structure, silique formation, seed yield)

Stress response phenotypes:

  • Hormone responses: Test sensitivity to ABA, auxin, gibberellins, and other phytohormones

  • Abiotic stress: Examine responses to drought, salt, cold, and heat stresses

  • Biotic stress: Evaluate resistance to bacterial, fungal, and insect pests

Barrier formation assessment:

  • Cuticular permeability: Test toluidine blue penetration, chlorophyll leaching, water loss rate

  • Suberin deposition: Analyze root and seed coat suberin using histochemical stains (Sudan Red, Fluorol Yellow)

  • Pollen wall integrity: Examine pollen viability, structure, and germination

Analytical approaches:

  • Microscopy: Use confocal, SEM, and TEM to examine cell wall and membrane structures

  • Metabolite profiling: Conduct LC-MS or GC-MS analysis of relevant compounds

  • Transcriptomics: Perform RNA-seq to identify genes with altered expression in mutants

Based on studies of related ABCG transporters, particular attention should be paid to potential roles in phytohormone transport, pathogen response, and formation of diffusion barriers. For example, mutations in related genes like ABCG16 show altered ABA sensitivity and reduced resistance to bacterial pathogens like Pseudomonas syringae .

How do ABCG23 structure and function compare to other ABCG transporters in Arabidopsis?

ABCG23 belongs to the half-size ABCG transporter subfamily, which requires dimerization to form functional units. A comparative analysis reveals:

Structural comparisons:

FeatureABCG23Other Half-size ABCGsFull-size ABCGs
DomainsSingle NBD + TMDSingle NBD + TMDDual NBD + TMD
Size~624 amino acids580-750 amino acids>1300 amino acids
TopologyN-terminal NBDN-terminal NBDN-terminal TMD
DimerizationRequiredRequiredNot required

Functional comparisons with characterized ABCG transporters:

ABCG MemberKnown FunctionSubstratesSimilarity to ABCG23
ABCG1/16Pollen wall development, ABA responseUnknownModerate sequence similarity
ABCG2/6/20Suberin formation in roots/seedsSuberin precursorsLow sequence similarity
ABCG11/12Cuticle formationCuticular lipidsModerate sequence similarity
ABCG13Cutin formation in flowersCutin monomersLow sequence similarity
ABCG32/PEC1Cuticular layer formationHydroxylated fatty acidsLow (full-size transporter)
ABCG29Lignin biosynthesisMonolignolsModerate sequence similarity

The ABCG subfamily in Arabidopsis shows remarkable functional diversity despite structural similarities. The substrate spectrum of different ABCG proteins is not always reflected by sequence identities between members, making functional prediction challenging based on sequence alone .

For ABCG23, detailed functional characterization requires both in vitro and in vivo studies to determine its specific substrates and physiological roles, as has been done for other family members.

What genetic approaches are most effective for studying ABCG23 function?

To comprehensively investigate ABCG23 function, researchers should employ multiple genetic tools:

Loss-of-function approaches:

  • T-DNA insertion lines: Obtain and characterize existing insertion lines from stock centers (SALK, SAIL, GABI-Kat). Verify insertion positions and expression levels.

  • CRISPR/Cas9 knockout: Generate precise gene disruptions, particularly useful for creating mutations in specific domains.

  • Artificial microRNA: Design amiRNAs targeting ABCG23 for tissue-specific or inducible knockdown.

  • RNAi constructs: Create hairpin constructs for post-transcriptional gene silencing.

Gain-of-function approaches:

  • Overexpression lines: Express ABCG23 under constitutive (35S) or inducible promoters.

  • Complementation: Express ABCG23 in knockout backgrounds under native or tissue-specific promoters.

  • Domain swapping: Create chimeric proteins with domains from related ABCG transporters to assess functional conservation.

Advanced genetic approaches:

  • Higher-order mutants: Generate double, triple, or quadruple mutants with closely related ABCG transporters to address redundancy issues.

  • Promoter-reporter fusions: Create ABCG23 promoter:GUS/GFP fusions to track expression patterns.

  • Protein-protein interaction studies: Use split-GFP, FRET, or BiFC to identify dimerization partners.

When working with ABCG23 mutants, researchers should carefully assess phenotypes across multiple developmental stages and environmental conditions, as related ABCG transporters have shown pleiotropic effects and environmentally dependent phenotypes .

How can protein localization and trafficking of ABCG23 be studied?

Understanding the subcellular localization and trafficking patterns of ABCG23 requires multiple complementary approaches:

Fluorescent protein fusion approaches:

  • C-terminal and N-terminal GFP fusions: Create both orientations to determine which preserves functionality.

  • Native promoter control: Express fusions under native promoter to maintain physiological expression levels.

  • Transient expression systems: Use Arabidopsis protoplasts or Nicotiana benthamiana leaves for rapid screening.

  • Stable transgenic lines: Generate stable Arabidopsis lines for detailed analysis across tissues and developmental stages.

Co-localization studies:

  • Subcellular markers: Co-express with markers for plasma membrane, tonoplast, ER, Golgi, and endosomes.

  • Membrane fractionation: Isolate different membrane fractions and detect ABCG23 via immunoblotting.

  • Immunogold labeling: Use electron microscopy with gold-labeled antibodies for high-resolution localization.

Trafficking studies:

  • Brefeldin A treatment: Assess sensitivity to inhibitors of vesicle trafficking.

  • Photoconvertible fluorescent tags: Use Dendra2 or mEOS to track protein movement over time.

  • FRAP (Fluorescence Recovery After Photobleaching): Measure protein mobility within membranes.

Based on studies of related ABCG transporters, ABCG23 is likely to localize to the plasma membrane rather than cell walls or intracellular membranes . Half-size ABCG transporters typically need to dimerize with partner proteins, so identifying interaction partners through co-immunoprecipitation or yeast two-hybrid screens will be crucial for understanding ABCG23 function.

What approaches should be used to identify and validate potential ABCG23 interacting partners?

Identifying protein-protein interactions for ABCG23 requires a multi-faceted approach:

In vivo interaction methods:

  • Co-immunoprecipitation (Co-IP): Express epitope-tagged ABCG23 in Arabidopsis, precipitate with antibodies, and identify interacting proteins via mass spectrometry.

  • Split-GFP complementation: Fuse ABCG23 and candidate partners with complementary GFP fragments to visualize interactions in planta.

  • Förster resonance energy transfer (FRET): Tag ABCG23 and candidates with donor/acceptor fluorophores to detect proximity-based energy transfer.

  • Bimolecular fluorescence complementation (BiFC): Similar to split-GFP but using split YFP fragments.

In vitro interaction methods:

  • Yeast two-hybrid (Y2H): Screen for interactions using ABCG23 domains as bait against cDNA libraries.

  • Pull-down assays: Use purified ABCG23 as bait to capture interactors from plant extracts.

  • Surface plasmon resonance (SPR): Measure direct binding between purified ABCG23 and candidate partners.

Computational prediction and validation:

  • Co-expression analysis: Identify genes with expression patterns similar to ABCG23.

  • Protein-protein interaction databases: Search existing databases for predicted interactions.

  • Domain-based predictions: Analyze specific domains known to mediate interactions.

For half-size ABCG transporters like ABCG23, dimerization is essential for forming functional units. Based on studies of related transporters, candidates for ABCG23 dimerization partners should include other half-size ABCG proteins. Since dimerization patterns affect substrate specificity, identifying these partners is crucial for understanding ABCG23 function .

Validation of interactions should include multiple independent techniques and functional assays to demonstrate biological relevance, such as co-localization in cellular compartments and phenotypic analysis of partner gene mutations.

How might understanding ABCG23 function contribute to improving crop stress tolerance?

ABCG transporters play crucial roles in plant stress responses, and understanding ABCG23 function could contribute to crop improvement strategies:

Potential applications based on ABCG transporter functions:

  • Enhanced barrier formation: Manipulation of ABCG23 expression could strengthen plant diffusion barriers (cuticle, suberin) to improve drought tolerance and pathogen resistance.

  • Optimized hormone transport: If ABCG23 transports phytohormones like ABA (similar to ABCG16), modulating its expression might enhance stress signaling and response pathways .

  • Improved pathogen resistance: Related ABCG transporters contribute to basal resistance against bacterial pathogens like Pseudomonas syringae. ABCG23 manipulation might enhance broad-spectrum disease resistance .

  • Secondary metabolite production: ABCG transporters often mediate the transport of specialized metabolites involved in defense responses. ABCG23 might be targeted to enhance the production of valuable compounds.

Translational research approaches:

  • Gene editing in crop species: Use CRISPR/Cas9 to modify ABCG23 orthologs in crops to enhance desired traits.

  • Expression modulation: Develop transgenic lines with altered ABCG23 expression under stress-inducible promoters.

  • Marker-assisted selection: Identify natural variants of ABCG23 associated with improved stress tolerance for breeding programs.

  • Synthetic biology approaches: Design optimized versions of ABCG23 with enhanced transport efficiency or altered substrate specificity.

Future research should focus on identifying the precise substrates and regulatory mechanisms of ABCG23, as this knowledge will be essential for targeted crop improvement strategies .

What are the current challenges and future directions in studying ABCG transporters like ABCG23?

Current challenges and future research directions for ABCG23 and related transporters include:

Technical challenges:

  • Substrate identification: Determining the actual transported molecules remains difficult for most ABCG transporters, including ABCG23. Future work should combine in vitro transport assays, metabolomics, and in vivo tracer studies .

  • Functional redundancy: Many ABCG transporters show overlapping functions, necessitating higher-order mutants and careful phenotypic analysis.

  • Membrane protein expression: Obtaining sufficient quantities of purified, functional ABCG transporters for biochemical studies remains challenging.

  • Complex regulation: Understanding the transcriptional, post-transcriptional, and post-translational regulation of ABCG23 requires integrative approaches.

Future research directions:

  • Structural studies: Obtain high-resolution structures of plant ABCG transporters to understand substrate binding sites and conformational changes.

  • Single-cell approaches: Implement single-cell transcriptomics and metabolomics to resolve cell-type-specific roles of ABCG transporters.

  • Systems biology integration: Place ABCG23 in broader signaling and metabolic networks to understand its contribution to plant physiology.

  • Translational research: Apply knowledge of ABCG transporters to improve crop traits through precision breeding and gene editing.

  • Comparative genomics: Study ABCG23 orthologs across diverse plant species to understand evolutionary conservation and specialization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.