Recombinant Arabidopsis thaliana ABC transporter G family member 26 (ABCG26)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of ABCG26

Gene Details

IdentifierValue
LocusAT3G13220
AliasesABCG26, MSR02, WBC27
Protein ClassABCG subfamily (PDR-type transporter)
Subcellular LocalizationPlasma membrane of tapetal cells

Key Applications:

  • Functional studies of sporopollenin trafficking mechanisms.

  • Protein interaction assays (e.g., substrate binding using biotinylated versions) .

Functional Role in Pollen Exine Formation

ABCG26 facilitates the transport of polyketide sporopollenin precursors from tapetal cells to microspores. Key findings include:

  • Genetic Evidence:

    • abcg26 mutants exhibit defective exine layers, leading to pollen collapse and male sterility .

    • Fluorescent vacuoles accumulate in tapetal cells of abcg26 mutants, indicating blocked polyketide export .

  • Substrate Specificity:

    • ABCG26 exports products of the polyketide synthesis metabolon (ACOS5, PKSA/B, TKPR1) .

    • Hydroxycinnamoyl spermidines, pollen coat components, are trafficked independently of polyketides .

Mechanistic Model:

  1. Polyketides synthesized in tapetal cells are exported via ABCG26 to form the sporopollenin backbone.

  2. Hydroxycinnamoyl spermidines are co-exported but via distinct pathways .

Comparative Analysis with Orthologs

SpeciesOrthologFunctionPhenotype of Mutant
Arabidopsis thalianaABCG26Sporopollenin precursor transportMale sterility, no exine
Oryza sativaABCG15/PDA1Lipid precursor transportAborted microspores, no orbicules

Research Challenges and Future Directions

  • Unresolved Questions:

    • Exact biochemical identity of transported polyketides remains unknown .

    • Dimerization partners of ABCG26 in planta are unconfirmed .

  • Technical Needs:

    • In vitro transport assays to validate substrate specificity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ABCG26; WBC27; At3g13220; MJG19.19; ABC transporter G family member 26; ABC transporter ABCG.26; AtABCG26; Putative white-brown complex homolog protein 27; AtWBC27
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-685
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ABCG26
Target Protein Sequence
MEIRRSTEEVEENHVMQITGSNGIVHNMEFMPQAYLRNQYSSEIDIDEEFVSTYPLEDAP LPIFLKFEDVEYKVRNSHASSANLVKTMVSKVVTHTNPDPDGYKHILKGITGSTGPGEIL ALMGPSGSGKTTLLKIMGGRLTDNVKGKLTYNDIPYSPSVKRRIGFVTQDDVLLPQLTVE ETLAFAAFLRLPSSMSKEQKYAKIEMIIKELGLERCRRTRVGGGFVKGISGGERKRASIA YEILVDPSLLLLDEPTSGLDSTSATKLLHILQGVAKAGRTVITTIHQPSSRMFHMFDKLL LISEGHPAFYGKARESMEYFSSLRILPEIAMNPAEFLLDLATGQVSDISLPDELLAAKTA QPDSEEVLLKYLKQRYKTDLEPKEKEENHRNRKAPEHLQIAIQVKKDWTLSWWDQFLILS RRTFRERRRDYFDKLRLVQSLGVAVVLGLLWWKSKTDTEAHLRDQVGLMFYICIFWTSSS LFGAVYVFPFEKIYLVKERKAEMYRLSVYYVCSTLCDMVAHVLYPTFFMIIVYFMAEFNR NIPCFLFTVLTILLIAITSQGAGEFLGASVLSIKRAGMIASLVLMLFLLTGGYYVQHIPK FMQWLKYLSFMHYGFRLLLKVQYSADQLFECGSKGGCRTLQSSSSFDTINLNGGLQELWV LLAMAFGYRLCAYFCLRKKISICHL
Uniprot No.

Target Background

Function
ABCG26 mediates the transport of sporopollenin precursors, such as polyketides, across the tapetum plasma membrane into the anther locule. These precursors then undergo polymerization on developing microspore walls. This process is essential for male fertility, pollen exine formation, and patterning before tapetum programmed cell death.
Gene References Into Functions
  1. ABCG26-exported polyketides traffic from tapetal cells to form the sporopollenin backbone, coordinated with the trafficking of additional constituents, prior to tapetum programmed cell death. PMID: 25415974
  2. AtABCG26 is essential for pollen development in Arabidopsis. An AtABCG26 mutant exhibits a male-sterile phenotype with very few pollen grains developed. PMID: 21696844
  3. Arabidopsis thaliana ABCG26 plays a crucial role in transferring sporopollenin lipid precursors from tapetal cells to anther locules, facilitating exine formation on the pollen surface. PMID: 21223384
  4. Findings suggest that the ABC transporter, WBC27 (AT3G13220), plays significant roles in Arabidopsis exine formation, potentially by translocating lipidic precursors of sporopollenin from tapetum to developing microspores PMID: 21205178
  5. ABCG26 is required for normal male fertility, exine formation, and pollen maturation. PMID: 20732973

Show More

Hide All

Database Links
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Mostly expressed in flowers, especially in tapetum within anthers.

Q&A

What is ABCG26 and what is its primary function?

ABCG26 is a member of the ATP-binding cassette (ABC) transporter superfamily in Arabidopsis thaliana. It functions primarily in pollen exine formation and is critical for male fertility. The protein belongs to the ABCG subfamily, which is particularly extensive in plants compared to other eukaryotes . ABCG26 plays a crucial role in transporting sporopollenin precursors from the tapetum to developing microspores for exine wall formation . Studies with abcg26 mutants have demonstrated that this transporter is essential for normal pollen development, as mutants exhibit severe fertility defects and abnormal pollen wall formation .

How does ABCG26 contribute to male reproductive development?

ABCG26 is specifically required for the formation of the pollen exine wall, which provides critical protection to developing pollen grains. The exine is composed primarily of sporopollenin, an extremely resistant biopolymer that shields pollen from environmental stresses . ABCG26 is expressed predominantly in the tapetum during early pollen wall formation, coinciding with sporopollenin biosynthesis and deposition . The protein is believed to transport sporopollenin precursors across the tapetal plasma membrane into the locule, where these compounds polymerize on the surface of developing microspores . Mutation of ABCG26 results in severe male fertility defects, with most siliques failing to produce seeds by self-fertilization and mature anthers failing to release pollen .

What phenotypes characterize abcg26 mutants?

The abcg26 mutants display several distinctive phenotypes:

  • Severely reduced fertility with most siliques failing to produce seeds through self-pollination

  • Mature anthers failing to release pollen

  • Complete absence of exine wall on mutant microspores

  • Abnormalities in pollen wall formation first appearing in early uninucleate microspores

  • Lack of sporopollenin deposition on developing microspores

  • Accumulation of lipidic structures in anther locules resembling those seen in other ABC transporter mutants (similar to trilamellar lipidic coils observed in abcg11 and abcg12 mutants)

How is ABCG26 related to other members of the ABCG subfamily?

ABCG26 belongs to the ABCG subfamily of ABC transporters, which is notably expansive in plants compared to other eukaryotes . The ABCG transporters in Arabidopsis can be categorized into several clades based on sequence similarity and function. While ABCG26 is specifically involved in pollen development, other ABCG members have diverse functions:

ABCG Member(s)Primary FunctionLocalizationPhenotypes in Mutants
ABCG26Pollen exine formationER and plasma membraneDefective pollen wall, male sterility
ABCG1, ABCG16Pollen wall synthesisPlasma membraneCompromised pollen integrity
ABCG2, ABCG6, ABCG20Suberin barrier formationPlasma membraneIncreased permeability in roots and seed coats
ABCG11/WBC11, ABCG12/CER5Cutin and wax transportPlasma membraneDefective cuticle formation
ABCG9, ABCG14, ABCG31Sterol ester transportPlasma membraneAltered sterol levels

Despite functional diversity, all these transporters utilize ATP hydrolysis to transport specific substrates across membranes . The substrate specificity is often determined by the transmembrane domains, while the cytoplasmic domains contain ATPase activity .

What methods are optimal for studying ABCG26 expression patterns?

Several complementary approaches can be employed to characterize ABCG26 expression patterns:

  • Promoter-Reporter Fusions: Creating ABCG26 promoter:GUS constructs allows visualization of tissue-specific expression patterns. This method has successfully shown expression in tapetal cells during pollen development .

  • RT-qPCR Analysis: For quantitative measurement of transcript levels across different tissues and developmental stages, allowing precise temporal expression profiling.

  • In Situ Hybridization: This technique provides high-resolution spatial information about ABCG26 mRNA localization within anther tissues.

  • Transcriptome Databases: Resources like ATTED-II and Aranet can identify genes co-expressed with ABCG26, providing insights into its functional network .

  • Translatome Analysis: This approach examines actively translated mRNAs in specific cell types, which has been valuable for analyzing expression of other ABCG transporters .

When analyzing expression data, researchers should account for potential hormonal regulation, as other ABCG transporters show responses to plant hormones like ABA .

How can protein localization studies enhance our understanding of ABCG26 function?

Protein localization studies are crucial for determining where ABCG26 functions within tapetal cells. Research has shown that yellow fluorescent protein (YFP)-ABCG26 fusion proteins localize to both the endoplasmic reticulum and plasma membrane in plant cells . This dual localization pattern provides important clues about ABCG26's role in sporopollenin precursor transport.

Recommended methods for protein localization include:

  • Fluorescent Protein Fusions: Creating N- or C-terminal fusions with fluorescent proteins like GFP or YFP for live-cell imaging.

  • Co-localization Studies: Using established organelle markers to confirm subcellular localization.

  • Immunolocalization: Employing antibodies against ABCG26 or epitope tags for fixed tissue analysis.

  • Membrane Fractionation: Biochemical separation of cellular compartments followed by Western blotting to detect ABCG26.

  • FRAP Analysis: Fluorescence recovery after photobleaching to assess protein mobility within membranes.

The plasma membrane localization supports the hypothesis that ABCG26 exports sporopollenin precursors from tapetal cells, while ER localization may indicate involvement in processing or trafficking of these compounds.

What approaches can identify the specific substrates transported by ABCG26?

Identifying the specific substrates of ABCG26 represents a significant challenge in understanding its biochemical function. Several complementary approaches can address this question:

  • Metabolomic Analysis: Comparing the metabolite profiles of wild-type and abcg26 mutant anthers can reveal accumulating precursors or depleted products. This approach should focus on potential sporopollenin components.

  • In Vitro Transport Assays: Reconstituting ABCG26 in liposomes or membrane vesicles and testing transport of radiolabeled or fluorescently labeled candidate substrates. This method requires purification of functional recombinant ABCG26 protein.

  • Heterologous Expression: Expressing ABCG26 in yeast, insect cells, or Xenopus oocytes to test transport capabilities across a range of potential substrates.

  • Structure-Function Analysis: Creating mutations in substrate-binding domains based on homology modeling to identify critical residues for substrate recognition.

  • Proximity Labeling: Using techniques like BioID or APEX to identify molecules in close proximity to ABCG26 during active transport.

These approaches are supported by the recommendation to combine in vitro and in vivo studies for ABCG transporters to clarify substrate identity, determine transport characteristics, and identify potential dimerization partners .

How does ABCG26 coordinate with sporopollenin biosynthetic enzymes?

The coordination between ABCG26 and sporopollenin biosynthetic enzymes involves complex spatial and temporal regulation. Current research supports the following model:

  • Coexpression Network: ABCG26 is likely coexpressed with genes involved in sporopollenin biosynthesis, similar to how other ABCG transporters (ABCG2, ABCG6, ABCG16, ABCG20) are coexpressed with suberin biosynthesis genes .

  • Developmental Timing: The highest expression of ABCG26 occurs in the tapetum during early pollen wall formation, coinciding with sporopollenin biosynthesis and deposition .

  • Metabolic Channeling: Biosynthetic enzymes may form complexes with ABCG26 at the plasma membrane to facilitate efficient transfer of sporopollenin precursors for export.

To investigate these coordination mechanisms, researchers should consider:

  • Analyzing protein-protein interactions between ABCG26 and known sporopollenin biosynthetic enzymes

  • Performing temporal transcriptome analysis to map the expression dynamics of the entire pathway

  • Using super-resolution microscopy to visualize potential enzyme-transporter complexes

  • Developing inducible expression systems to manipulate individual components of the pathway

What are the methodological challenges in purifying functional recombinant ABCG26?

Purifying functional recombinant ABCG26 presents several technical challenges:

  • Membrane Protein Solubilization: As a membrane protein, ABCG26 requires careful detergent selection to maintain structural integrity during extraction from membranes.

  • Expression Systems: Determining the optimal heterologous system (bacterial, yeast, insect cells, or plant-based) that supports proper folding and post-translational modifications.

  • Functional Assessment: Developing reliable assays to confirm that purified ABCG26 retains transport activity.

  • Stability Issues: ABC transporters often exhibit conformational flexibility essential for function but problematic for structural studies.

  • Dimerization Consideration: If ABCG26 functions as a dimer like other ABCG half-transporters, both homodimerization and potential heterodimerization must be considered .

Recommended approaches include:

  • Screening multiple detergents and solubilization conditions

  • Using GFP fusion strategies to monitor expression and purification efficiency

  • Employing nanodiscs or liposomes for reconstitution of purified protein

  • Considering co-expression with potential dimerization partners

The challenge of in vitro studies with ABC transporters is recognized in the literature, which emphasizes their importance for clarifying substrate identity, determining transport characteristics, and identifying dimerization partners .

How can gene editing technologies be applied to study ABCG26 function?

Modern gene editing technologies offer powerful approaches to study ABCG26 function with unprecedented precision:

  • CRISPR-Cas9 for Targeted Mutations:

    • Creating precise mutations in specific domains to determine structure-function relationships

    • Generating conditional knockouts using inducible Cas9 systems to bypass lethality issues

    • Introducing specific point mutations to dissect the role of critical amino acid residues

  • Base Editing and Prime Editing:

    • Making specific nucleotide changes without double-strand breaks

    • Introducing subtle modifications to regulatory elements to study expression control

  • CRISPR Activation/Interference (CRISPRa/CRISPRi):

    • Modulating ABCG26 expression levels without altering the genomic sequence

    • Studying dosage effects on pollen development

  • Epitope Tagging at Endogenous Loci:

    • Introducing fluorescent or affinity tags at the endogenous ABCG26 locus to study the native protein

  • Multiplexed Editing:

    • Simultaneously targeting ABCG26 and related transporters to study functional redundancy

For analyzing gene editing results, comprehensive phenotypic characterization should include pollen viability assays, transmission electron microscopy to examine exine structure, fertility assessments, and molecular characterization of sporopollenin composition.

What imaging techniques provide the most insight into ABCG26-related pollen development defects?

Advanced imaging techniques offer critical insights into the pollen development defects in abcg26 mutants:

  • Transmission Electron Microscopy (TEM):

    • Essential for visualizing ultrastructural defects in pollen wall formation

    • Can reveal the absence of exine walls in abcg26 mutant microspores

    • Allows detection of abnormal accumulations in anther locules resembling trilamellar lipidic coils

  • Confocal Laser Scanning Microscopy:

    • For tracking fluorescently tagged ABCG26 in living cells

    • Analyzing co-localization with other cellular components

  • Super-Resolution Microscopy:

    • Techniques like STORM or PALM can resolve ABCG26 distribution at nanometer scale

    • Useful for studying potential clustering or organization in membrane microdomains

  • Cryo-Electron Microscopy:

    • For preserving native structures without chemical fixation artifacts

    • Potentially suitable for studying membrane protein arrangements

  • Raman Microscopy/FTIR:

    • Non-destructive chemical imaging to analyze compositional changes in pollen walls

  • Correlative Light and Electron Microscopy (CLEM):

    • Combining fluorescence microscopy with EM for comprehensive analysis

Sample preparation protocols should be optimized for anthers at different developmental stages, with particular attention to preserving lipidic structures and delicate pollen wall components.

How can biochemical assays be designed to characterize ABCG26 transport activity?

Designing biochemical assays for ABCG26 transport activity requires careful consideration of the transporter's properties and potential substrates:

  • Membrane Vesicle Transport Assays:

    • Isolating plasma membrane vesicles from systems expressing ABCG26

    • Measuring ATP-dependent uptake or efflux of radiolabeled or fluorescent sporopollenin precursors

    • Using inside-out vesicles to measure transport in the physiologically relevant direction

  • ATPase Activity Measurements:

    • Quantifying ATP hydrolysis rates as an indirect measure of transport activity

    • Testing stimulation of ATPase activity by potential substrates

  • Reconstitution in Artificial Membrane Systems:

    • Incorporating purified ABCG26 into liposomes or nanodiscs

    • Measuring substrate transport across these defined membranes

    • Using fluorescent substrate analogs with quenching-based detection

  • Substrate Binding Assays:

    • Employing techniques like surface plasmon resonance or microscale thermophoresis

    • Determining binding affinities for candidate sporopollenin precursors

  • Competition Assays:

    • Using structurally related compounds to identify specificity determinants

These biochemical approaches address the recommendation that in vitro studies are essential to clarify substrate identity and transport characteristics of ABCG transporters . Positive and negative controls, including non-functional ABCG26 mutants and related ABCG transporters with different substrate specificities, should be included in all assays.

How might systems biology approaches advance our understanding of ABCG26 function?

Systems biology approaches can integrate multiple data types to provide a comprehensive understanding of ABCG26 function within the broader context of pollen development:

  • Multi-omics Integration:

    • Combining transcriptomics, proteomics, and metabolomics data from wild-type and abcg26 mutant anthers

    • Constructing regulatory networks that place ABCG26 in the context of pollen development pathways

    • Identifying potential feedback mechanisms that regulate ABCG26 expression

  • Co-expression Network Analysis:

    • Expanding on existing data showing co-expression of ABCG transporters with biosynthetic genes

    • Identifying novel genes that may function with ABCG26 in pollen wall formation

  • Comparative Genomics:

    • Analyzing ABCG26 orthologs across plant species to identify conserved features

    • Correlating evolutionary changes with differences in pollen wall architecture

  • Mathematical Modeling:

    • Developing kinetic models of sporopollenin precursor transport

    • Simulating the impact of ABCG26 activity on pollen wall formation dynamics

  • Single-cell Approaches:

    • Applying single-cell transcriptomics to tapetal cells to capture heterogeneity

    • Correlating ABCG26 expression with cellular differentiation states

These integrative approaches can reveal emergent properties not apparent from focused studies on ABCG26 alone, potentially identifying novel regulatory mechanisms and functional interactions.

What are the unresolved questions regarding ABCG26 regulation during pollen development?

Despite progress in understanding ABCG26 function, several key questions about its regulation remain unresolved:

  • Transcriptional Control:

    • Which transcription factors directly regulate ABCG26 expression?

    • How is ABCG26 expression coordinated with sporopollenin biosynthesis genes?

    • Based on studies of other ABCG transporters, how might plant hormones like ABA influence ABCG26 expression ?

  • Post-translational Regulation:

    • Are ABCG26 activity or localization regulated by phosphorylation or other modifications?

    • Does ABCG26 undergo endocytic recycling to modulate its abundance at the plasma membrane?

  • Substrate-induced Regulation:

    • Do sporopollenin precursors themselves regulate ABCG26 expression or activity?

    • Is there feedback inhibition when precursors accumulate?

  • Partner Proteins:

    • Does ABCG26 form heterodimers with other ABCG transporters, potentially affecting substrate specificity ?

    • Are there regulatory proteins that interact with ABCG26 to modulate its function?

  • Developmental Timing:

    • What mechanisms ensure the precise temporal expression of ABCG26 during tapetum and pollen development?

    • How is ABCG26 expression coordinated with tapetal programmed cell death?

Addressing these questions will require integrating genetic, biochemical, and cell biological approaches, potentially revealing new principles of plant reproductive development regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.