Recombinant Arabidopsis thaliana ABC transporter G family member 4 (ABCG4)

Shipped with Ice Packs
In Stock

Description

Protein Structure and Characterization

ABCG4 (UniProt ID: Q9SW08) is a 577-amino acid (aa) full-length transporter with a reverse domain organization (NBD-TMD) typical of plant ABCG proteins. Key structural features include:

AttributeDetails
Domain StructureN-terminal nucleotide-binding domain (NBD) fused to two transmembrane domains (TMDs)
Molecular WeightNot explicitly stated, but comparable to other full-length ABCG proteins (~60–70 kDa)
Post-Translational ModificationsHis-tag (N-terminal) for purification; recombinant versions often include glycerol for stability
SequenceIncludes motifs for ATP hydrolysis (Walker A/B) and substrate binding

The recombinant protein is expressed in E. coli and purified to >90% purity via SDS-PAGE . Its stability is enhanced with 6% trehalose in a Tris/PBS buffer (pH 8.0) .

Functional Roles in Plant Biology

ABCG4 is part of the ABCG subfamily, which in Arabidopsis includes 28 half-size and 15 full-size transporters . While its specific substrates remain unknown, ABCG transporters broadly participate in:

  • Phytohormone Transport: ABCG proteins mediate the movement of hormones like abscisic acid (ABA) and cytokinins .

  • Pathogen Response: ABCG transporters may export antimicrobial compounds or signaling molecules .

  • Diffusion Barriers: ABCG proteins contribute to cuticle and suberin formation, preventing water loss and pathogen invasion .

Knockout studies of ABCG members often reveal pleiotropic phenotypes, suggesting functional redundancy or overlapping roles .

Predicted Protein Interactions

ABCG4 interacts with diverse proteins, as inferred from STRING database predictions :

PartnerFunctionInteraction Score
ABCC2-2Chloroplastic fatty acyl-CoA transporter0.541
UGT79B3UDP-glycosyltransferase involved in secondary metabolism0.513
SKD1Regulates multivesicular body (MVB) sorting and Na⁺/K⁺ homeostasis0.482
GILPMembrane anchor for programmed cell death regulators0.480

These interactions suggest ABCG4 may collaborate in lipid transport, detoxification, or stress responses .

Challenges in Substrate Identification

Despite progress, ABCG4’s substrates remain elusive. Key hurdles include:

  • Sequence promiscuity: Low sequence identity between ABCG members does not correlate with substrate specificity .

  • Limited in vitro data: Reverse genetics alone cannot resolve substrate identity or transport directionality .

  • Dimerization complexity: ABCG proteins often form heterodimers (e.g., ABCG11/ABCG12), altering substrate profiles .

Research Applications and Future Directions

Recombinant ABCG4 enables studies on:

  1. Transport mechanism: ATP-dependent substrate translocation assays .

  2. Dimerization partners: Co-expression with other ABCG proteins to test functional pairings .

  3. Structural biology: Cryo-EM or X-ray crystallography to map substrate-binding sites.

Future directions include identifying ABCG4’s natural substrates and exploring its role in stress adaptation or phytohormone signaling .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is dependent on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized formulations, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. To maintain product quality, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
ABCG4; WBC4; At4g25750; F14M19.30; ABC transporter G family member 4; ABC transporter ABCG.4; AtABCG4; White-brown complex homolog protein 4; AtWBC4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-577
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ABCG4
Target Protein Sequence
MESYTLSTSSISYAKPLSPLLLTAEQPSFILRNITLTSHPSQILAIIGPSGAGKSTLLDI LAARTSPTSGSILLNSVLINPSSYRKISSYVPQHDTFFPLLTVSETFTFSASLLLPKNLS KVSSVVASLLKELNLTHLAHTRLGQGLSGGERRRVSIGLSLLHDPEVLLLDEPTSGLDSK SAFDVVQILKSIATSRERIVILSIHQPSFKILSLIDRVLLLSKGTIVYHGRLDLLEAFLL SKGFTVPSQLNSLEYAMEILQNIRDPYENANIALPDHCPESKKQNQKQSIVRYKSSRITE ISLLSSRFWKIIYRTRQLLLTNILESLVVGLVLGTIYLNIGTGKEGIRKRFGLFAFTLTF LLSSTTQTLPIFIDERPILLRETSSGLYRLSSHILANTLVFLPYLLLIAIIYSVSLYFLV GLCFSWQALAYFVLVIWIIVLMANSFVLFLSSLAPNYIAGTSSVTILLAAFFLFSGYFIS KESLPKYWLFMYFFSMYKYALDALLINEYSCLHNKCLVWFEEASVNSCLVTGGDVLDKNG LHERQRWFNVYMLLGFFVLYRVLCFLVLLKRVSGSKR
Uniprot No.

Target Background

Database Links

KEGG: ath:AT4G25750

STRING: 3702.AT4G25750.1

UniGene: At.32237

Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of ABCG4 in Arabidopsis thaliana?

ABCG4 belongs to the ATP-binding cassette (ABC) transporter G subfamily in Arabidopsis thaliana. This transporter contains characteristic nucleotide-binding domains (NBDs) that bind and hydrolyze ATP, and transmembrane domains (TMDs) that form the substrate translocation pathway. As part of the ABCG subfamily, it exists as either a half-size transporter requiring dimerization with another half-transporter to function, or as a full-size transporter containing two NBDs and two TMDs in a single polypeptide chain.

The dimerization properties significantly affect substrate specificity, as different combinations of half-transporters may recognize different substrates. This makes identification of dimerization partners critical for understanding ABCG4 function .

How is ABCG4 expression regulated in Arabidopsis tissues?

ABCG4 expression patterns in Arabidopsis are tissue-specific and can be modulated by environmental conditions. Similar to other ABCG transporters, ABCG4 expression may be regulated at both transcriptional and post-transcriptional levels. Studies of the broader ABCG subfamily indicate expression can be induced by various biotic and abiotic stresses, including pathogen infection, drought, and phytohormone signaling.

To analyze ABCG4 expression patterns:

  • Use qRT-PCR with ABCG4-specific primers for quantitative expression analysis

  • Employ promoter-reporter gene constructs (e.g., ABCG4pro:GUS) to visualize tissue-specific expression patterns

  • Perform RNA-seq analysis under different conditions to identify expression patterns

  • Western blotting with ABCG4-specific antibodies to analyze protein levels

What are the confirmed substrates transported by Arabidopsis ABCG4?

The exact substrates for Arabidopsis ABCG4 are still being fully characterized. Based on studies of ABCG transporters in plants and ABCG4 orthologs in other organisms, potential substrates may include:

  • Lipid compounds - ABCG transporters are known to transport various lipophilic compounds

  • Sterols - ABCG4 in mice has been shown to export desmosterol, suggesting plant ABCG4 might transport phytosterols

  • Phytohormones - Several ABCG family members transport plant hormones such as abscisic acid, cytokinin, or auxin

  • Secondary metabolites - Potentially involved in transport of defense compounds

To confirm substrate specificity, researchers should employ:

  • Transport assays with recombinant ABCG4 in heterologous expression systems

  • Metabolomics analysis comparing wild-type and ABCG4 mutant plants

  • Radiolabeled substrate efflux/uptake experiments

How does ABCG4 function differ from other ABCG family members in Arabidopsis?

The ABCG subfamily in Arabidopsis is extensive compared to other eukaryotes, with members involved in diverse processes including pathogen response, diffusion barrier formation, and phytohormone transport . While sequence identity between ABCG members doesn't always directly correlate with substrate specificity, functional differences exist:

ABCG MemberPrimary FunctionMain SubstratesExpression Pattern
ABCG4Under investigationPotentially sterols, lipidsMultiple tissues
ABCG1/G2/G6/G16/G20Cuticle formationCuticular wax precursorsEpidermal cells
ABCG25Abscisic acid transportAbscisic acidVascular tissues
ABCG36/G37Root exudation, pathogen resistanceCamalexin, other defense compoundsRoot epidermis
ABCG19Kanamycin resistanceAntibioticsVarious tissues

Understanding these functional differences requires both reverse genetics approaches and biochemical characterization of transport properties .

What are effective protocols for generating recombinant Arabidopsis ABCG4 for in vitro studies?

Producing functional recombinant ABCG4 requires careful consideration of expression systems and purification strategies:

Expression Systems:

  • Bacterial systems (E. coli):

    • Clone the ABCG4 coding sequence into pET vectors with His or GST tags

    • Express in specialized strains (C41/C43) optimized for membrane proteins

    • Limitations: May form inclusion bodies requiring refolding

  • Yeast systems (S. cerevisiae, P. pastoris):

    • Use GAL1 or AOX1 inducible promoters

    • Advantages: Post-translational modifications closer to plants

    • Protocol: Transform with ABCG4 in pYES2 or pPICZ vectors, induce with galactose or methanol

  • Insect cell systems (Sf9, High Five):

    • Generate recombinant baculovirus carrying ABCG4

    • Advantages: High expression of functional membrane proteins

    • Protocol: Clone ABCG4 into pFastBac vector, generate bacmid, transfect insect cells

Purification Strategy:

  • Solubilize membranes with mild detergents (DDM, LMNG)

  • Perform affinity chromatography using tag (IMAC for His-tag)

  • Size exclusion chromatography for final purification

  • Verify functional state through ATPase activity assays

How can I effectively conduct VIGS to study ABCG4 function in planta?

Virus-induced gene silencing (VIGS) offers a rapid approach to analyze ABCG4 function without stable transformation. Based on successful VIGS protocols for ABCG4 in other systems:

  • Vector construction:

    • Select 190-239 nucleotide fragments from ABCG4 coding sequence

    • Clone in antisense orientation into CMV-A1 vector or other plant virus vectors

    • Confirm insert maintenance through sequencing

  • Plant inoculation:

    • Inoculate 4-6 week old Arabidopsis plants with in vitro transcripts

    • Include appropriate controls: empty vector and non-target gene silencing

  • Silencing validation:

    • Perform qRT-PCR to confirm ABCG4 expression reduction

    • Allow 6+ days for complete silencing to establish in all tissues

    • Monitor ABCG4 transcript levels over time to determine silencing durability

  • Phenotypic analysis:

    • Document morphological changes

    • Perform biochemical analysis of potentially affected pathways

    • Compare with known ABCG4 mutant phenotypes

VIGS typically reduces gene expression by approximately 50%, as observed in similar studies with ABCG transporters .

What phenotypes are observed in Arabidopsis ABCG4 knockout mutants?

ABCG4 mutant phenotypes may display pleiotropic effects, as observed with other ABCG transporters. Potential phenotypes to investigate include:

  • Growth and development:

    • Measure growth parameters (height, biomass, root architecture)

    • Analyze developmental timing (germination, flowering)

    • Document any morphological abnormalities

  • Stress responses:

    • Test tolerance to drought, salt, and oxidative stress

    • Challenge with pathogens to assess disease resistance

    • Evaluate response to hormone treatments

  • Metabolic changes:

    • Perform untargeted metabolomics to identify accumulated or depleted compounds

    • Focus on sterol content given the role of ABCG4 in sterol transport in other organisms

    • Analyze cuticle composition and integrity

  • Transport assays:

    • Measure uptake/efflux of potential substrates in wild-type vs. mutant tissues

    • Analyze root exudation profiles

    • Test transpiration rate and stomatal conductance

Studies of ABC transporters frequently reveal pleiotropic phenotypes where the same protein may appear to have different physiological roles in different contexts .

How can I distinguish between direct and indirect effects in ABCG4 mutant phenotypes?

Distinguishing primary from secondary effects requires multiple complementary approaches:

  • Complementation analysis:

    • Transform ABCG4 mutants with wild-type ABCG4 under native promoter

    • Create point mutations in ATP-binding domains to generate transport-deficient controls

    • Use tissue-specific promoters to restore function in specific tissues

  • Time-course analysis:

    • Document the sequential appearance of phenotypes

    • Primary defects typically appear earlier than secondary consequences

  • Biochemical validation:

    • Perform in vitro transport assays with purified ABCG4 to confirm direct substrate interactions

    • Use mutated versions of ABCG4 to correlate transport activity with phenotypic rescue

  • Epistasis analysis:

    • Cross ABCG4 mutants with mutants of potential interacting pathways

    • Analyze double mutant phenotypes to establish genetic relationships

How does ABCG4 in Arabidopsis compare functionally to ABCG4 in other organisms?

ABCG4 function appears to be partially conserved across species while maintaining organism-specific adaptations:

OrganismABCG4 FunctionSubstrate SpecificityCellular Localization
Arabidopsis thalianaPotential roles in sterol transport, stress responseUnder investigationPlasma membrane (predicted)
Mus musculusExports desmosterol and amyloid-β peptideDesmosterol, cholesterol, amyloid-βBlood-brain barrier endothelial cells
AphidsInvolved in wing developmentUnknownMultiple tissues

Mouse ABCG4 functions at the blood-brain barrier to export desmosterol and amyloid-β peptide, with molecular modeling suggesting thermodynamically favorable binding of desmosterol at the sterol-binding site . This suggests that plant ABCG4 might similarly transport sterols, though the specific phytosterols involved may differ.

Research has demonstrated that ABCG4 silencing in aphids inhibits wing formation, suggesting developmental functions that may not be conserved in plants .

What post-translational modifications regulate ABCG4 function?

Post-translational modifications (PTMs) significantly affect ABC transporter function, though specific modifications of Arabidopsis ABCG4 are still being characterized:

  • Phosphorylation:

    • Potential regulation by protein kinases in response to environmental cues

    • Methods to investigate: Phosphoproteomic analysis, site-directed mutagenesis of predicted phosphorylation sites

  • Glycosylation:

    • May affect protein stability and trafficking

    • Detection methods: Glycoprotein staining, enzymatic deglycosylation, mass spectrometry

  • Ubiquitination:

    • Potential regulation of protein turnover and endocytic trafficking

    • Investigation approaches: Immunoprecipitation with ubiquitin antibodies, proteasome inhibitor treatments

  • S-acylation:

    • May affect membrane association and microdomain localization

    • Analysis methods: Acyl-biotin exchange assay, metabolic labeling with palmitic acid

To study these modifications:

  • Generate site-specific mutants targeting predicted modification sites

  • Perform immunoprecipitation followed by mass spectrometry

  • Use phosphatase/glycosidase treatments to assess functional impacts

How can I overcome expression and purification challenges with recombinant ABCG4?

Membrane proteins like ABCG4 present unique challenges for recombinant expression and purification:

  • Low expression yields:

    • Optimize codon usage for expression system

    • Test multiple fusion tags (His, MBP, SUMO) to improve solubility

    • Screen expression temperatures (lower temperatures often improve folding)

    • Use specialized expression strains with extra chaperones

  • Protein instability:

    • Screen detergent panel (DDM, LMNG, GDN) for optimal extraction

    • Include stabilizing additives (glycerol, cholesterol hemisuccinate)

    • Use thermostability assays to identify optimal buffer conditions

    • Consider nanodiscs or SMALPs for detergent-free purification

  • Inactive protein:

    • Verify ATP binding using ATP-agarose pull-down

    • Perform ATPase assays to confirm enzymatic activity

    • Use fluorescent substrate analogs to test transport function

    • Reconstitute in proteoliposomes to measure transport activity

  • Aggregation issues:

    • Use size exclusion chromatography to monitor oligomeric state

    • Add specific lipids that may be required for stability

    • Optimize protein concentration and storage conditions

What are effective strategies to resolve conflicting data about ABCG4 function?

Conflicting results about ABCG4 function may arise from different experimental approaches:

  • Reconcile in vivo and in vitro data:

    • Compare knockout/knockdown phenotypes with biochemical transport studies

    • Consider that pleiotropy may explain apparently contradictory functions

    • Evaluate whether presumed "direct" effects may be secondary consequences

  • Address experimental limitations:

    • Different expression systems may affect protein function

    • Heterologous expression might lack required partners or cofactors

    • Transport assays may have different sensitivities or dynamic ranges

  • Methodological approaches:

    • Perform side-by-side comparisons using standardized protocols

    • Use multiple independent techniques to verify key findings

    • Consider tissue-specific or developmental context differences

    • Implement genetic complementation to confirm cause-effect relationships

  • Consider dimerization complexity:

    • Half-size ABCG transporters require dimerization

    • Different dimerization partners could explain different substrate specificities

    • Verify dimerization status in different experimental systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.