Recombinant Arabidopsis thaliana ABC transporter G family member 8 (ABCG8)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant ABCG8

Recombinant ABCG8 is a full-length protein (1–589 amino acids) derived from Arabidopsis thaliana (UniProt ID: Q9FLX5). Key specifications include:

PropertyDetails
Expression SystemEscherichia coli (E. coli)
TagN-terminal His tag for purification
Protein Length589 amino acids
Purity≥85–90% (verified by SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); store at -20°C/-80°C

The amino acid sequence includes conserved ABC transporter motifs (e.g., Walker A/B, Signature motifs) critical for ATP hydrolysis and substrate transport .

Functional Roles of ABCG8 in Plants

ABCG8 belongs to the ABCG subfamily, which mediates the transport of lipids, phytohormones, and secondary metabolites. Key findings:

  • Sterol Transport: Homologs of ABCG8 in mammals (e.g., human ABCG5/G8) form heterodimers to export cholesterol and phytosterols . In plants, ABCG8 is hypothesized to participate in sterol homeostasis, though direct substrates remain unconfirmed .

  • Pathogen Defense: Plant ABCG transporters contribute to cuticular lipid deposition, forming barriers against pathogens .

  • Dimerization: Like human ABCG5/G8, plant ABCG transporters likely function as heterodimers, though dimerization partners for ABCG8 are not yet identified .

Research Applications

Recombinant ABCG8 is used to:

  • Study Substrate Specificity: In vitro assays to identify transported sterols or signaling molecules .

  • Characterize ATPase Activity: Measure Mg²⁺-dependent ATP hydrolysis kinetics .

  • Investigate Mutational Effects: Example: The G574R mutation in human ABCG8 disrupts sterol transport; analogous residues in plant ABCG8 may reveal functional conservation .

Unresolved Questions

  • Substrate Identification: Despite homology to sterol transporters, ABCG8’s native substrates in Arabidopsis remain unconfirmed .

  • Dimerization Partners: Unlike human ABCG5/G8, plant ABCG8’s binding partner(s) are unknown .

  • Regulatory Mechanisms: Post-translational modifications or interacting proteins modulating ABCG8 activity are unexplored .

Comparative Analysis with Human ABCG8

FeatureArabidopsis ABCG8Human ABCG8
FunctionHypothesized sterol transportSterol excretion (bile, intestines)
Disease AssociationNone reportedSitosterolemia, gallstones
Structural DataHomology models based on ABCG5/G8 Cryo-EM structures resolved (3.3 Å)

Key Research Gaps

  • In Vivo Validation: Knockout or overexpression studies in Arabidopsis to confirm physiological roles .

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve plant ABCG8’s architecture .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ABCG8; WBC8; At5g52860; MXC20.8; ABC transporter G family member 8; ABC transporter ABCG.8; AtABCG8; Probable white-brown complex homolog protein 8; AtWBC8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-589
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
Target Protein Sequence
MEIPPSPPPETAAYTLTTSSISYTIPKTSLSLLRFPATEPPSFILRNITLTAHPTEILAV VGPSGAGKSTLLDILASKTSPTSGSILLNSIPINPSSYRKISSYVPQHDSFFPLLTVSET FSFAACLLLPNPSIVSETVTSLLSELNLTHLSHTRLAQGLSGGERRRVSIGLSLLHDPCF LLLDEPTSGLDSKSAFDVIHILKSIAVSRQRTVILSIHQPSFKILSIIDRLLLLSKGTVV YHGRLDSLEGFLLFKGFTVPPQLNSLEYAMEILQELRESDGNTDATALPSIENRKQREKQ SIVRYRKSRITEISLLARRFWKIIYRTRQLLLTNALEALVVGLVLGTIYINIGIGKAGIE KRFGMFAFTLTFLLSSTTETLPIFINERPILLRETSSGIYRLSSHILANTLVFLPYLFVI SIIYSVSVYFLIGLCPTWQAFGYFVLVIWIILLMANSFVLFLSSLAPNYITGTSLVTILL AAFFLFSGYFISKESLPKYWLFMYFFSMYKYALDALLINEYSCLASKCLVWLEEAQTKIC MVTGGDVLKKKGLHEKQRWFNVYVLLGFFVLYRVLCFLALLRRVSGSKR
Uniprot No.

Target Background

Database Links

KEGG: ath:AT5G52860

STRING: 3702.AT5G52860.1

UniGene: At.29590

Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Arabidopsis thaliana ABCG8 and how is it classified within the ABC transporter family?

ABCG8 (AT5G52860, also called WBC8 or AtABCG8) is a member of the ATP-binding cassette (ABC) transporter G subfamily in Arabidopsis thaliana. It belongs to the half-transporter category of ABC proteins, containing one nucleotide-binding domain (NBD) and one transmembrane domain (TMD). The ABCG subfamily is the largest ABC transporter group in plants, with 28 half-transporters identified in Arabidopsis . ABCG transporters are involved in diverse biological processes including lipid transport, hormone regulation, and defense responses.

Which expression systems have been successfully used for recombinant AtABCG8 production?

Recombinant Arabidopsis thaliana ABCG8 has been successfully expressed in E. coli expression systems . The recombinant protein is typically produced with an N-terminal His-tag to facilitate purification. While E. coli is most commonly used, other potential expression systems include:

  • Yeast expression systems (Saccharomyces cerevisiae or Pichia pastoris)

  • Baculovirus-insect cell expression systems

  • Mammalian cell expression systems

The choice of expression system depends on research requirements, especially when studying protein functionality, as membrane proteins often require eukaryotic systems for proper folding and post-translational modifications.

What are the recommended methods for purifying recombinant AtABCG8?

For His-tagged recombinant AtABCG8, the recommended purification protocol involves:

  • Cell lysis using appropriate buffer systems (often containing detergents for membrane protein solubilization)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar matrices

  • Size exclusion chromatography for further purification

  • Verification of purity by SDS-PAGE (>85% purity is generally achievable)

For storage, the purified protein should be aliquoted to avoid repeated freeze-thaw cycles and stored at -20°C or -80°C. The recommended buffer often includes 6% trehalose at pH 8.0 to maintain protein stability .

How can researchers assess the transport activity of recombinant AtABCG8?

Transport activity of AtABCG8 can be assessed through multiple methodological approaches:

  • ATPase assays: Measuring ATP hydrolysis rates in the presence of potential substrates can indicate transport activity. This can be performed using colorimetric assays that detect inorganic phosphate release.

  • Vesicle transport assays: Reconstituting the purified protein into liposomes and measuring substrate transport across these artificial membranes.

  • Heterologous expression systems: Expressing AtABCG8 in yeast mutants lacking specific transporters, then assessing complementation of phenotypes.

  • Radioisotope-labeled substrate transport: Using labeled potential substrates to directly measure transport activity in cellular or vesicular systems expressing AtABCG8.

When designing these experiments, it's important to consider that ABCG transporters may function as homo- or heterodimers, as seen with mammalian ABCG transporters .

Does AtABCG8 function as a homodimer or heterodimer, and with which partners?

While definitive evidence for AtABCG8 dimerization partners is limited, research with other ABC transporters suggests it likely functions as a dimer. Studies with mammalian ABCG transporters have shown that they can form either obligate heterodimers (like ABCG5/ABCG8) or homodimers (like ABCG2) .

In Arabidopsis, several ABCG transporters have been shown to dimerize. For example, phylogenetic analysis places AtABCG8 in Clade 1-5 of the half-size ABCG transporters , suggesting potential functional relationships with other members of this clade. Researchers should consider testing interaction with other ABCG family members through methods such as:

  • Yeast two-hybrid assays

  • Co-immunoprecipitation

  • FRET/BRET analyses in planta

  • Co-expression analysis based on transcriptomic data

What are the known physiological functions of AtABCG8 in Arabidopsis thaliana?

AtABCG8 is involved in several physiological processes, though its precise functions are still being elucidated:

  • Stress responses: Transcriptomic analysis indicates AtABCG8 is downregulated under certain stress conditions, with a fold change of 0.31 in treated roots compared to controls .

  • Developmental processes: The ABCG subfamily in Arabidopsis is involved in anther and pollen development, vegetative growth, and female organ development .

  • Disease resistance: AtABCG8 has been implicated in plant defense mechanisms through transcriptomic analyses of disease resistance responses .

Unlike its mammalian counterpart that functions in sterol transport, the plant ABCG8 likely has evolved different substrate specificities and physiological roles adapted to plant biology.

How is AtABCG8 expression regulated at the transcriptional level?

AtABCG8 expression appears to be regulated by several factors:

  • Hormone responsiveness: Many ABC transporters in Arabidopsis respond to hormones like abscisic acid (ABA). For instance, transcription factors AtMYC2 (bHLH) and AtMYB2 function as transcriptional activators in ABA-inducible gene expression , which may influence ABCG8 expression.

  • Environmental stresses: Expression analysis shows AtABCG8 is downregulated (fold change of 0.31) in certain stress conditions , suggesting stress-responsive elements in its promoter.

  • Developmental cues: Given the involvement of ABCG transporters in developmental processes, AtABCG8 expression likely varies across different tissues and developmental stages.

Researchers can investigate transcriptional regulation through:

  • Promoter analysis to identify regulatory elements

  • Chromatin immunoprecipitation (ChIP) to identify transcription factor binding

  • Gene expression profiling across tissues and conditions

How can CRISPR/Cas9 be used to study AtABCG8 function in planta?

CRISPR/Cas9 genome editing provides powerful approaches for studying AtABCG8 function:

  • Complete gene knockout: Design sgRNAs targeting early exons of AtABCG8 to create frameshift mutations and functional knockouts.

  • Domain-specific mutations: Target specific functional domains (e.g., ATP-binding sites or transmembrane regions) to analyze their contributions to transporter function.

  • Promoter modification: Edit regulatory regions to alter expression patterns and study the effects on plant development and stress responses.

  • Fluorescent protein tagging: Insert fluorescent protein coding sequences to create fusion proteins for subcellular localization studies.

When designing CRISPR experiments, researchers should consider:

  • Potential off-target effects by performing whole-genome sequencing

  • The creation of multiple independent lines to confirm phenotypes

  • Complementation studies to verify the specificity of observed phenotypes

What approaches are recommended for studying AtABCG8 subcellular localization and trafficking?

Several complementary approaches can be used to study AtABCG8 localization and trafficking:

  • Fluorescent protein fusions: Similar to methods used for AtABCG25 , researchers can create N- or C-terminal YFP/GFP fusions of AtABCG8 and express them transiently using particle bombardment or stably through Agrobacterium-mediated transformation.

  • Immunolocalization: Using specific antibodies against AtABCG8 or its epitope tags for immunofluorescence microscopy.

  • Subcellular fractionation: Isolating different membrane fractions (plasma membrane, ER, Golgi) followed by Western blotting to detect AtABCG8.

  • Co-localization studies: Examining overlap with known markers for different cellular compartments.

For trafficking studies, researchers can use:

  • Inhibitors of vesicular trafficking

  • Temperature-sensitive trafficking mutants

  • Photoactivatable or photoconvertible fluorescent proteins to track protein movement

How does AtABCG8 compare structurally and functionally to mammalian ABCG8?

While sharing the same nomenclature, plant and mammalian ABCG8 transporters show important differences:

FeatureArabidopsis thaliana ABCG8Mammalian ABCG8
StructureHalf-transporter (single NBD and TMD)Half-transporter (single NBD and TMD)
DimerizationPotential homo- or heterodimer (partners not fully established)Obligate heterodimer with ABCG5
Physiological roleLikely involved in defense responses and stress adaptationSterol transport (biliary cholesterol secretion, intestinal sterol absorption limitation)
Subcellular localizationNot definitively establishedApical membranes of enterocytes and hepatocytes
Substrate specificityNot fully characterizedCholesterol and plant sterols
Associated disordersNone reportedSitosterolemia when mutated

These differences reflect the evolutionary divergence of plant and animal ABCG transporters to serve kingdom-specific physiological needs.

What insights can phylogenetic analysis provide about AtABCG8 evolution and function?

Phylogenetic analysis places AtABCG8 within the half-size ABCG transporters of Arabidopsis, which can be further classified into five clades (1-1 to 1-5) . This classification provides several insights:

  • Functional predictions: Other members of the same clade may have similar functions, substrates, or expression patterns.

  • Evolutionary history: The diversification of plant ABCG transporters is thought to be associated with adaptation to the land environment .

  • Potential redundancy: Closely related transporters may have overlapping functions, explaining why single knockout phenotypes might be subtle.

  • Cross-species comparisons: Identifying orthologous ABCG transporters in crop species could reveal conserved functions and inform agricultural applications.

Researchers can use these evolutionary relationships to guide functional studies and interpret experimental results in a broader biological context.

What are common challenges in working with recombinant AtABCG8 and how can they be addressed?

Working with membrane transporters like AtABCG8 presents several challenges:

  • Low expression levels:

    • Solution: Optimize codon usage for the expression host

    • Use stronger promoters or inducible expression systems

    • Consider fusion partners that enhance solubility

  • Protein misfolding and aggregation:

    • Solution: Express in eukaryotic systems that better support membrane protein folding

    • Use mild detergents for solubilization

    • Consider expression at lower temperatures

  • Maintaining protein stability:

    • Solution: Add stabilizing agents like glycerol (recommended 5-50%)

    • Avoid repeated freeze-thaw cycles

    • Use appropriate buffer components (e.g., Tris/PBS-based buffer with 6% trehalose at pH 8.0)

  • Assessing functionality:

    • Solution: Develop robust functional assays

    • Consider reconstitution into proteoliposomes

    • Use appropriate controls to validate transport activity

How can researchers interpret contradictory results from different experimental approaches to AtABCG8 function?

When facing contradictory results regarding AtABCG8 function:

  • Consider experimental context:

    • Different expression systems may affect protein folding and function

    • In vitro versus in vivo approaches may yield different results due to missing cofactors or interacting partners

    • Verify that the full-length protein was used in all experiments

  • Evaluate technical variables:

    • Check for differences in experimental conditions (pH, temperature, ionic strength)

    • Assess protein quality and purity across experiments

    • Consider the sensitivity and specificity of detection methods

  • Integrate multiple approaches:

    • Combine genetic evidence (knockouts, complementation) with biochemical data

    • Use both in vitro and in vivo approaches

    • Apply both gain-of-function and loss-of-function strategies

  • Consider biological complexity:

    • AtABCG8 may have multiple substrates with different affinities

    • Transport activity may be regulated by post-translational modifications

    • Functional redundancy with other transporters may mask phenotypes

What are the most promising approaches for identifying AtABCG8 substrates?

Identifying the substrates of AtABCG8 represents a significant challenge that can be addressed through:

  • Metabolomic profiling: Compare metabolite profiles of wild-type and AtABCG8 knockout/overexpression lines to identify accumulated or depleted compounds.

  • Transport assays with candidate substrates: Based on known substrates of other ABCG transporters (lipids, hormones, defense compounds), test transport activity with these candidates.

  • Binding assays: Develop in vitro binding assays using purified AtABCG8 and potential substrates, monitoring changes in protein conformation or thermal stability.

  • Genetic approaches: Perform suppressor screens on AtABCG8 mutant phenotypes to identify genes and pathways functionally connected to AtABCG8.

  • Computational prediction: Use protein modeling and docking simulations to predict potential binding sites and substrate interactions, particularly using insights from mammalian ABCG structures .

How might research on AtABCG8 contribute to improving crop resilience to environmental stresses?

Understanding AtABCG8 function could contribute to crop improvement in several ways:

  • Stress resistance engineering: If AtABCG8 is involved in stress responses (as suggested by its downregulation under certain conditions ), manipulating its expression might enhance plant tolerance to environmental stresses.

  • Pathogen resistance: Transcriptomic analyses suggest AtABCG8 may play a role in disease resistance responses . Understanding this role could inform strategies for enhancing crop resistance to pathogens.

  • Developmental optimization: Given the involvement of ABCG transporters in plant development, including reproductive organs , modulating AtABCG8 expression might improve crop reproductive success under stress conditions.

  • Cross-species applications: Identifying orthologous transporters in crop species could allow targeted breeding or engineering for improved transport of beneficial compounds.

  • Hormone transport regulation: If AtABCG8 is involved in hormone transport, as are other ABCG family members , manipulating its expression could allow fine-tuning of hormone levels for optimal growth under specific conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.