Recombinant Arabidopsis thaliana ABC transporter G family member 9 (ABCG9)

Shipped with Ice Packs
In Stock

Description

Introduction to ABCG9

ABCG9 is a half-size ABC transporter within the G subfamily, characterized by a reverse domain architecture (nucleotide-binding domain [NBD] at the N-terminus and transmembrane domain [TMD] at the C-terminus) . It is encoded by the AT4G27420 gene and is predominantly expressed in the tapetum of Arabidopsis flowers and vascular tissues . Recombinant ABCG9 is produced heterologously in systems like E. coli, yeast, or mammalian cells for functional studies .

Domain Organization

ABCG9 follows the typical half-transporter structure:

  • NBD: Binds and hydrolyzes ATP to energize substrate transport.

  • TMD: Forms the substrate translocation pathway .

Pollen Coat Formation and Stress Resistance

ABCG9, in conjunction with ABCG31, mediates the transfer of steryl glycosides from tapetal cells to the pollen surface. Key findings include:

  • Knockout Phenotype: abcg9 abcg31 double mutants exhibit shriveled pollen grains under dry conditions due to defective pollen coat maturation .

  • Lipid Analysis: Steryl glycoside levels in mutant pollen are reduced by ~50%, impairing pollen fitness .

  • Localization: GFP-tagged ABCG9 localizes to the plasma membrane of tapetal cells during microspore development .

Vascular Development

ABCG9 interacts with ABCG11 and ABCG14 to regulate lipid/sterol homeostasis critical for phloem development:

  • Mutant Phenotypes: Semi-dominant mutations cause vascular patterning defects in cotyledons and floral stems .

  • Dimerization: Forms heterodimers with ABCG11 (flexible pairing) and ABCG14 (strict heterodimers) .

Table 1: Phenotypic and Functional Insights from ABCG9 Studies

Study FocusMethodologyKey ResultsReferences
Pollen Coat Defectsabcg9 abcg31 knockout + lipidomicsReduced steryl glycosides; pollen collapse
Vascular DevelopmentCo-IP, BiFC, metabolomicsLipid homeostasis disruption in phloem
Substrate TransportGFP localization, RT-PCRTapetum-specific expression; plasma membrane

Recombinant ABCG9 in Experimental Applications

Recombinant ABCG9 enables:

  • Antibody Development: Polyclonal antibodies generated in rabbits for immunodetection .

  • Functional Assays: In vitro transport studies to identify substrates (e.g., sterols, lipids) .

  • Structural Studies: Resolving transport mechanisms via heterologous expression .

Unresolved Questions and Future Directions

  • Substrate Specificity: While steryl glycosides are implicated, direct transport evidence is lacking .

  • Dimerization Partners: Full functional characterization requires identifying in planta interaction partners .

  • Biophysical Studies: In vitro reconstitution of ABCG9 to analyze ATPase activity and transport directionality .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify your requirement when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of the product depends on several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us and we will prioritize developing the product with the specified tag.
Synonyms
ABCG9; WBC9; At4g27420; F27G19.20; ABC transporter G family member 9; ABC transporter ABCG.9; AtABCG9; Probable white-brown complex homolog protein 9; AtWBC9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-638
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ABCG9
Target Protein Sequence
MDNQEVSMDVETPIAKTNDDRSLPFSIFKKANNPVTLKFENLVYTVKLKDSQGCFGKNDK TEERTILKGLTGIVKPGEILAMLGPSGSGKTSLLTALGGRVGEGKGKLTGNISYNNKPLS KAVKRTTGFVTQDDALYPNLTVTETLVFTALLRLPNSFKKQEKIKQAKAVMTELGLDRCK DTIIGGPFLRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDSTTAQRIVSILWELARG GRTVVTTIHQPSSRLFYMFDKLLLLSEGNPVYFGLGSNAMDYFASVGYSPLVERINPSDF LLDIANGVGSDESQRPEAMKAALVAFYKTNLLDSVINEVKGQDDLCNKPRESSRVATNTY GDWPTTWWQQFCVLLKRGLKQRRHDSFSGMKVAQIFIVSFLCGLLWWQTKISRLQDQIGL LFFISSFWAFFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFLSRVVGDLPMELILPTCF LVITYWMAGLNHNLANFFVTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLTFL LAGGYYVQHVPVFISWIKYVSIGYYTYKLLILGQYTANELYPCGDNGKLRCHVGDFEGIK HIGFNSGLVSALALTAMLVVYRVIAYIALTRIGKTKSG
Uniprot No.

Target Background

Function
ABCG9, in conjunction with ABCG31, plays a role in the deposition of steryl glycosides in the pollen coat, which is essential for pollen fitness. Alongside ABCG11 and ABCG14, ABCG9 is crucial for vascular development by regulating lipid/sterol homeostasis.
Gene References Into Functions
  1. ABCG9, ABCG11, and ABCG14 are expressed in the vascular system. Mutations in these genes are associated with defects in plant growth and altered vascular patterning. [ABCG9] PMID: 24112720
Database Links

KEGG: ath:AT4G27420

STRING: 3702.AT4G27420.1

UniGene: At.32102

Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Present in flowers and siliques, at lower levels in leaves and stems, but barely in roots. Accumulates in the phloem. Highly expressed in the tapetum of anthers.

Q&A

What is ABCG9 and what is its role in Arabidopsis thaliana?

ABCG9 is an ATP Binding Cassette transporter belonging to the G subfamily member 9 in Arabidopsis thaliana. Research has demonstrated that ABCG9 is highly expressed in the tapetum (the innermost layer of the anther wall) and plays a critical role in pollen coat deposition. Together with ABCG31, it contributes to the accumulation of steryl glycosides on the pollen surface, which is essential for pollen fitness and protection against environmental stresses like drought and cold . The specific mechanism involves the transfer of pollen coat material, particularly steryl glycosides, from maternal tissues to the pollen surface .

How is recombinant ABCG9 protein typically produced for research purposes?

Recombinant ABCG9 protein for research applications is typically expressed in E. coli expression systems with an N-terminal His-tag for easier purification. The protein is supplied as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . For reconstitution, researchers should:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50% is recommended)

  • Aliquot for long-term storage at -20°C to -80°C

Repeated freeze-thaw cycles should be avoided to maintain protein activity, and working aliquots can be stored at 4°C for up to one week .

What phenotypes are observed in ABCG9 knockout mutants versus ABCG9/ABCG31 double knockout mutants?

The phenotypic differences between single and double knockout mutants provide crucial insights into functional redundancy in the ABC transporter family:

ParameterABCG9 Single KnockoutABCG9/ABCG31 Double Knockout
Pollen viability under normal conditionsNormalReduced
Response to dry airMinimal effectMany pollen grains shrivel and collapse
Pollen coat ultrastructureNear-normalResembles immature coat with electron-lucent structures
Steryl glycoside levelsSlight reductionReduced to approximately 50% of wild-type levels
Free sterolsNormalNormal
Steryl estersNormalNormal
Phenotype rescueN/ARestored by complementation with ABCG9pro:GFP:ABCG9

The absence of observable phenotypes in single knockout mutants, but clear deficiencies in double knockouts, strongly suggests functional redundancy between ABCG9 and ABCG31 in pollen coat formation .

How does ABCG9 contribute to steryl glycoside transport and pollen fitness?

ABCG9 and ABCG31 are plasma membrane-localized transporters (as confirmed by GFP-tagged localization studies) that facilitate the transfer of steryl glycosides to the pollen surface . The molecular mechanism appears to involve:

  • Expression of ABCG9 and ABCG31 in the tapetum

  • Transport of steryl glycosides across the plasma membrane

  • Deposition of these compounds on the developing pollen surface

  • Formation of a mature pollen coat that protects against environmental stresses

This process is critical for pollen fitness, as demonstrated by the following evidence:

  • Double knockout mutants show compromised pollen survival under dry conditions

  • Electron microscopy reveals immature pollen coat structure in mutants

  • Steryl glycoside levels are significantly reduced in mutant pollen

  • Similar phenotypes are observed in the ugt80A2 ugt80B1 mutant deficient in steryl glycoside biosynthesis

What experimental approaches are most effective for studying ABCG9 function in planta?

The most effective experimental approaches for studying ABCG9 function in planta combine genetic, molecular, biochemical, and microscopic techniques:

  • Genetic approaches:

    • Generation of single and double knockout mutants using T-DNA insertion lines

    • Complementation studies using promoter:protein:reporter constructs

    • Creation of steryl glycoside biosynthesis mutants for comparative phenotyping

  • Molecular approaches:

    • Expression analysis using qRT-PCR to determine tissue-specific expression patterns

    • Protein localization using GFP/fluorescent protein fusions

    • Promoter analysis to understand temporal and spatial regulation

  • Biochemical approaches:

    • Lipidomic analysis to quantify steryl glycosides, free sterols, and steryl esters

    • Transport assays using radiolabeled or fluorescently tagged substrates

    • Protein-protein interaction studies to identify partners and regulatory networks

  • Microscopic techniques:

    • Electron microscopy to analyze pollen coat ultrastructure

    • Confocal microscopy for protein localization

    • Environmental stress assays to evaluate pollen fitness under controlled conditions

Each of these approaches has contributed to our current understanding of ABCG9 function, with the combined genetic-biochemical approach being particularly informative in establishing the link between transporter activity and steryl glycoside accumulation .

How can researchers optimize expression and purification of recombinant ABCG9?

Optimizing expression and purification of recombinant ABCG9 requires careful attention to several factors:

  • Expression system selection:

    • E. coli is commonly used but may require optimization for membrane protein expression

    • Consider codon optimization for the expression host

    • Evaluate alternative expression systems (insect cells, yeast) for higher yield or proper folding

  • Fusion tag selection:

    • His-tag is standard for purification via immobilized metal affinity chromatography (IMAC)

    • Consider dual tags (His-MBP, His-SUMO) to improve solubility

    • Include TEV or PreScission protease sites for tag removal if needed for functional studies

  • Expression conditions:

    • Optimize temperature (typically lower temperatures of 16-20°C improve folding)

    • Adjust induction conditions (IPTG concentration, induction time)

    • Test various media formulations and additives that stabilize membrane proteins

  • Purification strategy:

    • Use mild detergents for solubilization (DDM, LMNG, or others)

    • Implement multi-step purification (IMAC followed by size exclusion chromatography)

    • Include stabilizing agents throughout purification (glycerol, specific lipids)

  • Storage and handling:

    • Store in buffer containing glycerol to prevent aggregation

    • Aliquot to avoid freeze-thaw cycles

    • Consider flash-freezing in liquid nitrogen for long-term storage

What are the key considerations for designing ABCG9 functional assays?

Designing effective functional assays for ABCG9 requires careful consideration of its native environment and substrates:

  • Substrate selection:

    • Use steryl glycosides as primary substrate based on in vivo function

    • Consider fluorescently labeled steryl glycosides for tracking transport

    • Include appropriate controls (non-transportable analogs, ATP-binding site mutants)

  • Assay system development:

    • Reconstitute purified protein in liposomes for transport studies

    • Use inside-out membrane vesicles from expression systems

    • Consider whole-cell assays with labeled substrates

  • Detection methods:

    • HPLC or LC-MS for quantitative analysis of transported steryl glycosides

    • Fluorescence-based detection for real-time transport kinetics

    • Radiolabeled substrate assays for high sensitivity

  • Data analysis:

    • Determine transport kinetics (Km, Vmax)

    • Assess ATP dependence and the effect of ATPase inhibitors

    • Evaluate substrate specificity across different steryl glycoside variants

  • Validation approaches:

    • Compare wild-type and mutant proteins (ATP-binding site mutants)

    • Test competitive inhibitors

    • Correlate in vitro transport with in vivo phenotypes

These considerations ensure that the functional assays provide meaningful insights into ABCG9's transport mechanism and substrate specificity.

How does ABCG9 research contribute to our understanding of plant reproduction and stress tolerance?

Research on ABCG9 provides several important insights into plant reproduction and stress tolerance:

  • Pollen development and viability:

    • ABCG9 research has revealed the critical role of steryl glycosides in pollen coat formation

    • Understanding the molecular mechanisms of pollen protection against environmental stresses

    • Identifying key transporters involved in maternal-to-pollen material transfer

  • Plant lipid transport mechanisms:

    • ABCG9 studies illuminate how plants transport specific lipid species

    • Research reveals functional redundancy in the ABC transporter family

    • Provides insights into the specialization of different transporters for different lipid classes

  • Abiotic stress responses:

    • ABCG9's role in protecting pollen from desiccation connects to broader drought tolerance mechanisms

    • Understanding how plants prepare reproductive cells for environmental challenges

    • Potential applications in developing crops with improved reproductive success under stress conditions

  • Cell type-specific transport processes:

    • ABCG9 expression in the tapetum highlights the importance of specialized transport in specific tissues

    • Research demonstrates how transport processes are coordinated during plant development

    • Provides a model for studying other tissue-specific transport phenomena

This research area continues to evolve, with implications for basic plant biology and potential agricultural applications.

What are the emerging techniques for studying ABCG9 and related transporters?

Several cutting-edge techniques are advancing our understanding of ABCG9 and related transporters:

  • Cryo-electron microscopy (Cryo-EM):

    • Determination of high-resolution structures of plant ABC transporters

    • Visualization of substrate binding sites and conformational changes during transport

    • Insights into the structural basis of substrate specificity

  • Single-molecule techniques:

    • Real-time observation of individual transporter molecules

    • Characterization of conformational dynamics during transport cycle

    • Direct measurement of substrate binding and release events

  • Advanced genetic tools:

    • CRISPR/Cas9-mediated precise genome editing for studying specific domains

    • Inducible expression systems for temporal control of transporter function

    • Cell type-specific knockouts to dissect tissue-specific roles

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, lipidomics)

    • Network analysis to identify interacting partners and regulatory components

    • Mathematical modeling of transport processes and their impact on cellular physiology

  • Advanced imaging technologies:

    • Super-resolution microscopy for precise subcellular localization

    • Live-cell imaging to track transporter dynamics

    • Correlative light and electron microscopy to connect function with ultrastructure

These emerging techniques promise to provide deeper insights into ABCG9 function and regulation in the coming years.

What are the major contradictions or inconsistencies in the current ABCG9 research literature?

Several unresolved questions and apparent contradictions exist in the current ABCG9 research:

  • Substrate specificity:

    • While steryl glycosides are implicated as substrates, direct transport evidence is limited

    • The structural basis for substrate recognition remains poorly understood

    • Potential transport of additional substrates has not been fully explored

  • Functional redundancy:

    • The functional overlap between ABCG9 and ABCG31 is established, but contributions of other transporters remain unclear

    • The need for multiple transporters with similar functions raises questions about evolutionary advantages

    • Tissue-specific differences in redundancy have not been fully characterized

  • Regulation mechanisms:

    • Factors controlling ABCG9 expression, localization, and activity remain poorly understood

    • Post-translational modifications and their impact on transport function need further investigation

    • Environmental influences on ABCG9 activity require additional research

  • Phenotypic variations:

    • Inconsistencies in reported phenotype severity across different studies

    • Variable effects under different environmental conditions

    • Potential ecotype-specific differences in ABCG9 function and importance

Addressing these contradictions will require comprehensive studies using multiple approaches and carefully controlled experimental conditions.

What are the most significant knowledge gaps in ABCG9 research that require further investigation?

Several critical knowledge gaps represent important directions for future ABCG9 research:

  • Structural determinants of transport:

    • High-resolution structural data for ABCG9 is lacking

    • Structure-function relationships for substrate binding and translocation remain undefined

    • Conformational changes during the transport cycle need characterization

  • Regulatory networks:

    • Transcriptional, post-transcriptional, and post-translational regulation mechanisms

    • Protein-protein interactions that modulate ABCG9 function

    • Integration of ABCG9 activity with broader cellular signaling networks

  • Evolutionary conservation and divergence:

    • Functional comparison of ABCG9 orthologs across plant species

    • Diversification of substrate specificity in the ABCG subfamily

    • Evolutionary pressures driving redundancy in steryl glycoside transport

  • Broader physiological roles:

    • Potential functions beyond pollen development

    • Role in responses to biotic and abiotic stresses

    • Possible involvement in plant-environment interactions

  • Translational applications:

    • Potential for improving crop reproductive success under stress conditions

    • Engineering modified transporters with enhanced or altered functions

    • Development of ABCG9-targeted approaches for plant improvement

Addressing these knowledge gaps will provide a more comprehensive understanding of ABCG9 function and its importance in plant biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.