Recombinant Arabidopsis thaliana Abscisic acid 8'-hydroxylase 2 (CYP707A2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CYP707A2; At2g29090; T9I4.17; Abscisic acid 8'-hydroxylase 2; ABA 8'-hydroxylase 2; Cytochrome P450 707A2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-482
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CYP707A2
Target Protein Sequence
MQISSSSSSNFFSSLYADEPALITLTIVVVVVVLLFKWWLHWKEQRLRLPPGSMGLPYIG ETLRLYTENPNSFFATRQNKYGDIFKTHILGCPCVMISSPEAARMVLVSKAHLFKPTYPP SKERMIGPEALFFHQGPYHSTLKRLVQSSFMPSALRPTVSHIELLVLQTLSSWTSQKSIN TLEYMKRYAFDVAIMSAFGDKEEPTTIDVIKLLYQRLERGYNSMPLDLPGTLFHKSMKAR IELSEELRKVIEKRRENGREEGGLLGVLLGAKDQKRNGLSDSQIADNIIGVIFAATDTTA SVLTWLLKYLHDHPNLLQEVSREQFSIRQKIKKENRRISWEDTRKMPLTTRVIQETLRAA SVLSFTFREAVQDVEYDGYLIPKGWKVLPLFRRIHHSSEFFPDPEKFDPSRFEVAPKPYT YMPFGNGVHSCPGSELAKLEMLILLHHLTTSFRWEVIGDEEGIQYGPFPVPKKGLPIRVT PI
Uniprot No.

Target Background

Function

CYP707A2 is involved in the oxidative degradation of abscisic acid (ABA), although it does not participate in the isomerization of the resulting 8'-hydroxyabscisic acid (8'-OH-ABA) to (-)-phaseic acid (PA). This enzyme plays a crucial role in regulating seed dormancy and germination.

Gene References Into Functions
  1. Genetic analysis demonstrates that NLP8-mediated nitrate-induced promotion of seed germination requires CYP707A2. PMID: 27731416
  2. Glucose-induced delays in seed germination and seedling development are directly linked to the suppression of ABA catabolism via repression of CYP707A2 expression. PMID: 21883251
  3. CYP707A2 transcript levels increase from late maturation to mature dry seed, indicating a distinct role in seed development and post-germination growth. PMID: 16543410
  4. CYP707A2 plays a central role in nitrate-mediated control of ABA levels during Arabidopsis thaliana seed development and germination. PMID: 19074630
Database Links

KEGG: ath:AT2G29090

STRING: 3702.AT2G29090.1

UniGene: At.50108

Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Mainly expressed in dry seeds. Lower expression in rosette leaves, flowers, siliques and stems. Not expressed in roots. Expressed in both endosperm and vascular tissues of embryo during the seed development and in cortex and endodermis in germinating embr

Q&A

What is CYP707A2 and what distinguishes it from other members of the CYP707A family?

CYP707A2 is one of four members (CYP707A1-CYP707A4) of the cytochrome P450 CYP707A family in Arabidopsis thaliana that catalyzes the 8'-hydroxylation of abscisic acid (ABA), the rate-limiting step in ABA catabolism. This hydroxylation produces 8'-hydroxy-ABA, which spontaneously isomerizes to phaseic acid (PA) .

While all four CYP707A family members catalyze the same basic reaction, they differ in their spatiotemporal expression patterns. CYP707A2 is predominantly expressed in dry seeds and during early seed imbibition, whereas other family members show different tissue specificity and developmental regulation . Unlike some other family members, CYP707A2 plays a particularly crucial role in seed dormancy regulation, as evidenced by the hyperdormancy phenotype of cyp707a2 mutants .

How does the catalytic mechanism of CYP707A2 function in ABA catabolism?

CYP707A2 functions as a classical cytochrome P450 monooxygenase, requiring NADPH and molecular oxygen as cofactors for the hydroxylation reaction . The reaction proceeds through the following steps:

  • Binding of (+)-S-ABA substrate to the enzyme's active site

  • Electron transfer from NADPH via a reductase

  • Activation of molecular oxygen

  • Hydroxylation at the 8'-position of ABA

  • Formation of 8'-hydroxy-ABA, which spontaneously cyclizes to phaseic acid (PA)

The enzyme shows stereospecificity, efficiently converting (+)-S-ABA (the natural form) but not binding to or metabolizing (-)-R-ABA . Notably, CYP707A2 catalyzes only the hydroxylation step; the isomerization of 8'-hydroxy-ABA to PA occurs spontaneously and is not enzyme-catalyzed .

What expression systems are most effective for producing functional recombinant CYP707A2?

Based on published research, three main expression systems have been successfully used to produce functional CYP707A2:

  • Yeast expression system: Transformation of yeast with full-length CYP707A2 cDNA allows for functional expression. Microsomal fractions from transformed yeast can be used for in vitro enzyme assays, with activity confirmed by the production of phaseic acid in the presence of NADPH and (+)-S-ABA .

  • Insect cell/baculovirus system: This system has yielded high enzymatic activity, with CYP707A2 expressed in insect cells showing efficient metabolism of (+)-ABA to phaseic acid. The microsomes from these cells exhibit strong 8'-hydroxylation activity with favorable kinetic parameters .

  • E. coli expression: While more challenging for membrane-bound cytochrome P450s, optimized protocols have been developed for expression in E. coli, particularly useful for site-directed mutagenesis studies .

The choice of expression system depends on research objectives, with the insect cell system generally providing the highest activity for detailed biochemical characterization.

What are the optimal assay conditions for measuring CYP707A2 activity in vitro?

Optimal conditions for CYP707A2 enzyme assays include:

ParameterOptimal ConditionNotes
Buffer100 mM phosphate buffer, pH 7.5Other buffers may significantly reduce activity
Cofactor0.5-1 mM NADPHNADH is not an effective cofactor (only 3-5% of NADPH activity)
Temperature22-30°CMost assays performed at room temperature (22°C)
Substrate concentration30-50 μM (+)-S-ABAFor standard assays; Km ≈ 1.3 μM
Protein sourceMicrosomal fractionContains membrane-bound enzyme
OxygenAerobic conditions requiredMolecular oxygen is a substrate
Incubation time30-60 minutesLinearity should be confirmed

Activity is typically measured by quantifying the formation of phaseic acid using HPLC or GC-MS analysis . The addition of NADH (5 mM) alongside suboptimal NADPH concentrations can demonstrate synergistic effects, enhancing hydroxylase activity . Notably, activity is inhibited by P450 inhibitors such as tetcyclacis (10 μM reduces activity by approximately 95%), while metyrapone (10 μM) shows no inhibitory effect .

How is CYP707A2 expression regulated during development and in response to environmental stimuli?

CYP707A2 expression is highly regulated both developmentally and in response to environmental cues:

  • Seed development and germination: CYP707A2 mRNAs accumulate highly in dry seeds and are rapidly induced within 6 hours of imbibition, correlating with decreased ABA levels . This temporal pattern distinguishes it from other CYP707A family members and explains its predominant role in controlling seed dormancy.

  • Nitrate response: Both exogenous and endogenous nitrate induce CYP707A2 expression. When seeds are imbibed in 10 mM nitrate, CYP707A2 expression increases approximately 5-fold compared to imbibition in water, correlating with lower ABA levels . Additionally, CYP707A2 mRNA levels in developing siliques positively correlate with nitrate doses applied to mother plants .

  • Nitric oxide (NO) signaling: NO rapidly induces CYP707A2 expression during seed imbibition. This NO-induced CYP707A2 upregulation correlates with decreased ABA levels and is required for breaking seed dormancy .

  • Stress responses: All CYP707A genes, including CYP707A2, are upregulated during drought stress conditions. Upon rehydration, a significant increase in mRNA levels is observed, helping to reduce ABA levels and allow recovery .

The complex regulation of CYP707A2 involves both transcriptional and post-transcriptional mechanisms that fine-tune ABA catabolism in response to various internal and external signals.

What techniques are most reliable for quantifying CYP707A2 gene expression?

Based on published literature, several complementary approaches provide reliable quantification of CYP707A2 expression:

  • Quantitative Real-Time PCR (qRT-PCR): This is the most widely used method for precise quantification of CYP707A2 transcript levels. Published primers and TaqMan probes have been optimized for specificity:

    • Forward primer: 5′-CGTCTCTCACATCGAGCTCCTT-3′

    • Reverse primer: 5′-CCAAAAGTCCATCAACACCCTC-3′

    • TaqMan Probe: 5′FAM-TCCTCCAAACCCTTTCCTCTTGGACG-TAMRA 3′

  • DNA Microarray Analysis: Useful for global expression profiling, as demonstrated in studies comparing CYP707A2 expression in response to nitrate treatment .

  • Western Blotting: For protein-level quantification, especially useful when transcript and protein levels might not correlate. Anti-CYP707A2 antibodies have been used to monitor protein expression changes in response to NO signaling .

  • Promoter-Reporter Constructs: CYP707A2 promoter fused to reporter genes (GUS, LUC) allows visualization of spatial expression patterns and response to various treatments.

When designing experiments to measure CYP707A2 expression, normalization to appropriate reference genes (e.g., 18S rRNA at 1000× dilution has been used successfully) is essential for accurate quantification .

What phenotypes are observed in cyp707a2 mutants and how do they inform our understanding of CYP707A2 function?

Analysis of cyp707a2 knockout mutants has revealed several key phenotypes that illuminate the physiological functions of CYP707A2:

  • Seed dormancy: cyp707a2 mutants (cyp707a2-1 and cyp707a2-2) exhibit significantly delayed germination when seeds are sown without stratification, demonstrating hyperdormancy. This phenotype can be rescued by stratification for 4 days, confirming CYP707A2's role in breaking seed dormancy .

  • ABA accumulation: The mutant seeds accumulate approximately six-fold higher ABA levels in dry seeds compared to wild-type, and these elevated ABA levels persist even after 24 hours of imbibition . This directly demonstrates CYP707A2's central role in controlling seed ABA levels.

  • ABA sensitivity: cyp707a2 mutant germination is inhibited by low concentrations (0.5 μM) of exogenous ABA after stratification, indicating increased sensitivity to ABA .

  • Nitrate response: The cyp707a2-1 mutant shows reduced sensitivity to both endogenous and exogenous nitrate for breaking seed dormancy, failing to reduce seed ABA levels in response to nitrate treatments. This underlines CYP707A2's central role in nitrate-mediated control of seed dormancy .

Interestingly, while the seed dormancy phenotypes are pronounced, cyp707a2 mutants display only subtle phenotypes during other developmental stages, suggesting functional redundancy with other CYP707A family members outside of seed germination contexts .

How does CYP707A2 interact with nitrate and nitric oxide signaling pathways to regulate seed dormancy?

CYP707A2 serves as a critical integration point between nitrate/nitric oxide signaling and ABA metabolism to regulate seed dormancy:

  • Nitrate signaling: Nitrate treatment induces CYP707A2 expression, which leads to increased ABA catabolism and reduced ABA levels in seeds . This occurs through two mechanisms:

    • Exogenous nitrate: When present in the germination medium, nitrate rapidly induces CYP707A2 expression (approximately 5-fold increase after 6 hours of imbibition), resulting in lower ABA levels and reduced dormancy .

    • Endogenous nitrate: When provided to mother plants during seed development, nitrate influences CYP707A2 expression in developing siliques, resulting in seeds with lower ABA content and reduced dormancy .

  • Nitric oxide pathway: NO serves as a signaling molecule in breaking seed dormancy. During early imbibition, NO is rapidly released at the endosperm layer, preceding the enhancement of ABA catabolism . This NO accumulation induces CYP707A2 transcription and protein expression, leading to increased ABA catabolism. The rapid decrease in ABA concentration triggered by NO is required for breaking seed dormancy .

The integration of these signaling pathways through CYP707A2 allows seeds to respond appropriately to environmental conditions, with nitrate serving as an indicator of favorable germination conditions.

What strategies can be employed to distinguish the specific functions of CYP707A2 from other members of the CYP707A family?

Given the functional overlap among CYP707A family members, several strategies can effectively isolate CYP707A2-specific functions:

  • Temporal expression analysis: High-resolution time-course studies during seed imbibition can distinguish CYP707A2's early role (0-6 hours) from later-acting family members . Combining transcript analysis with ABA quantification at these time points provides functional correlation.

  • Single and multiple mutant analysis: Comparing phenotypes of single mutants (cyp707a1, cyp707a2, cyp707a3, cyp707a4) with various double, triple, and quadruple mutant combinations can reveal both unique and redundant functions. The hyperdormancy phenotype of cyp707a2 singles (not observed in cyp707a3 mutants) demonstrates its predominant role in seed dormancy .

  • Tissue-specific expression: Utilizing promoter-reporter constructs for each CYP707A family member can map their distinct spatial expression domains. For CYP707A2, strong expression in seeds versus other tissues highlights its specialized function .

  • Stimulus-specific responses: Different family members show distinct responses to environmental stimuli. The strong induction of CYP707A2 by nitrate and NO distinguishes it from other family members in seed germination contexts .

  • Complementation studies: Expressing CYP707A2 under control of tissue-specific or inducible promoters in the cyp707a2 mutant background can confirm which phenotypes are directly attributable to CYP707A2 function in specific contexts.

These approaches collectively enable delineation of CYP707A2's specific functions while accounting for potential compensatory effects from other family members.

What are the most effective methods for analyzing CYP707A2 enzyme kinetics and substrate specificity?

Rigorous analysis of CYP707A2 enzyme properties requires careful experimental design:

  • Kinetic parameter determination:

    • Optimal enzyme source: Recombinant CYP707A2 expressed in insect cells using the baculovirus system provides the highest activity (Km = 1.3 μM, kcat = 15 min-1 for (+)-ABA) .

    • Substrate range: 0.1-50 μM (+)-S-ABA for Km determination via Lineweaver-Burk or Eadie-Hofstee plots.

    • Product quantification: HPLC with UV detection (262 nm) using a reverse-phase column and isocratic elution with 75:25 (v/v) mixture of aqueous 1% acetic acid and acetonitrile .

    • Time course analysis: Ensuring linearity of the reaction over the assay period.

  • Substrate specificity assessment:

    • Testing both (+)-S-ABA and (-)-R-ABA enantiomers (only the natural (+)-S-ABA serves as substrate) .

    • Binding studies with solubilized CYP707A2 protein (Ks = 3.5 μM for (+)-ABA, no binding detected for (-)-ABA) .

    • Analysis of potential alternative substrates (other sesquiterpenoids or related compounds).

    • Competition assays with structural analogs to identify key binding determinants.

  • Inhibitor studies:

    • P450 inhibitors: Tetcyclacis (effective) versus metyrapone (ineffective) demonstrate selectivity in the active site .

    • Structure-activity relationship analysis using various inhibitor concentrations.

    • Competitive versus non-competitive inhibition patterns to elucidate binding modes.

  • Reaction product analysis:

    • LC-MS/MS for detailed characterization of reaction products.

    • Analysis of potential secondary reactions (e.g., verification that CYP707A2 catalyzes only hydroxylation and not the subsequent isomerization to PA) .

    • Use of isotopically labeled substrates ([1,2-13C2]-(±)-ABA) to trace product formation .

These approaches provide comprehensive characterization of CYP707A2's enzymatic properties and substrate requirements, essential information for understanding its physiological function and potential for biotechnological applications.

How can CYP707A2 be utilized in agricultural biotechnology to improve crop traits?

CYP707A2's central role in ABA catabolism offers several potential agricultural applications:

  • Seed dormancy modification: Targeted modulation of CYP707A2 expression could create crops with:

    • Reduced dormancy for uniform germination in favorable conditions

    • Enhanced dormancy to prevent pre-harvest sprouting in cereals

    • Improved stress tolerance during germination

  • Drought tolerance engineering: Given that CYP707A genes are upregulated during drought stress and rehydration , precisely controlling CYP707A2 expression could:

    • Enhance stomatal closure during water deficit by maintaining higher ABA levels

    • Accelerate recovery upon rewatering through rapid ABA catabolism

    • Create crops with improved water use efficiency

  • Nitrogen response optimization: Since CYP707A2 mediates nitrate effects on seed dormancy , engineering this pathway could:

    • Enhance seed germination responses to soil nitrogen availability

    • Optimize crop establishment in varying nitrogen conditions

    • Create varieties with tailored germination requirements for specific agricultural systems

  • Seed quality improvement: Manipulating maternal CYP707A2 expression during seed development could:

    • Produce seeds with predetermined dormancy levels

    • Improve seed storability and longevity

    • Enhance seed vigor and stress resistance

Future research should focus on creating crop-specific CYP707A2 variants with modified regulatory elements for context-dependent expression, potentially using CRISPR/Cas9 genome editing for precise modifications without introducing transgenic sequences.

What are the key unresolved questions regarding CYP707A2 function and regulation that warrant further investigation?

Despite significant advances, several important questions about CYP707A2 remain unanswered:

  • Structural determinants of function:

    • What structural features determine CYP707A2's substrate specificity and catalytic efficiency?

    • How does the protein structure accommodate ABA binding and catalysis?

    • Which amino acid residues are critical for substrate recognition versus catalytic activity?

  • Regulatory mechanisms:

    • What transcription factors directly control CYP707A2 expression in response to environmental signals?

    • How are nitrate and NO signaling pathways integrated at the CYP707A2 promoter?

    • What post-translational modifications regulate CYP707A2 enzyme activity?

  • Cellular localization and trafficking:

    • Where is CYP707A2 precisely localized within the cell?

    • How does subcellular localization affect its access to the ABA substrate?

    • What membrane insertion and trafficking mechanisms control CYP707A2 distribution?

  • Evolutionary significance:

    • How has CYP707A2 evolved compared to homologs in other plant species?

    • What selective pressures have shaped its specialized role in seed dormancy?

    • How do CYP707A enzymes in non-seed plants differ in function and regulation?

  • Interaction with other pathways:

    • How does CYP707A2 activity coordinate with ABA biosynthesis to control ABA homeostasis?

    • What is the relationship between CYP707A2 and other hormone signaling pathways (GA, ethylene)?

    • How do epigenetic mechanisms contribute to CYP707A2 regulation during stress responses?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.