Recombinant Arabidopsis thaliana Acyl-CoA-binding domain-containing protein 2 (ACBP2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
ACBP2; At4g27780; T27E11.20; Acyl-CoA-binding domain-containing protein 2; Acyl-CoA binding protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ACBP2
Target Protein Sequence
MGDWAQLAQSVILGLIFSYLLAKLISIVVTFKEDNLSLTRHPEESQLEIKPEGVDSRRLD SSCGGFGGEADSLVAEQGSSRSDSVAGDDSEEDDDWEGVESTELDEAFSAATLFVTTAAA DRLSQKVPSDVQQQLYGLYKIATEGPCTAPQPSALKMTARAKWQAWQKLGAMPPEEAMEK YIEIVTQLYPTWLDGGVKAGSRGGDDAASNSRGTMGPVFSSLVYDEESENELKIDAIHGF AREGEVENLLKSIESGIPVNARDSEGRTPLHWAIDRGHLNIAKVLVDKNADVNAKDNEGQ TPLHYAVVCDREAIAEFLVKQNANTAAKDEDGNSPLDLCESDWPWIRDSAKQAD
Uniprot No.

Target Background

Function

Recombinant Arabidopsis thaliana Acyl-CoA-binding domain-containing protein 2 (ACBP2) binds medium- and long-chain acyl-CoA esters with high affinity. While it interacts in vitro with palmitoyl-CoA, interaction with oleoyl-CoA is not observed. It also binds lead ions (Pb). ACBP2 may function as an intracellular acyl-CoA ester carrier and is crucial for maintaining proper phospholipid and, to a lesser extent, galactolipid composition.

Gene References Into Functions
  1. ACBP2, exhibiting 76.9% amino acid homology to ACBP1, did not appear involved in the freezing response. PMID: 20404541
  2. Findings suggest a positive role for ACBP2 in abscisic acid signaling during germination, seedling development, and drought response. PMID: 22788984
  3. ACBP2 mediates tolerance to Cd(II)-induced oxidative stress by interacting with AtFP6 and lysoPL2. PMID: 20657176
  4. ACBP2 binds lysoPL2, promoting lysophosphatidylcholine degradation in response to Cd-induced oxidative stress. PMID: 20345607
  5. ACBP1 and ACBP2 are essential for lipid transfer during early Arabidopsis embryogenesis. PMID: 20345632
  6. ACBP2 interacts with AtFP6; an ACBP2 derivative lacking ankyrin repeats did not show this interaction, indicating that the ankyrin repeats mediate the interaction. Plants overexpressing ACBP2 or AtFP6 exhibited increased tolerance to Cd(II) compared to wild-type plants. PMID: 18823312
Database Links

KEGG: ath:AT4G27780

STRING: 3702.AT4G27780.1

UniGene: At.25382

Protein Families
ACBP family
Subcellular Location
Cell membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein. Peroxisome membrane; Single-pass membrane protein.
Tissue Specificity
Mostly expressed in roots and flowers, and, to a lower extent, in stems, pods and leaves (at protein level).

Q&A

What is the domain organization of Arabidopsis ACBP2?

ACBP2 contains three distinct functional domains: an acyl-CoA-binding domain that shows conservation with cytosolic ACBPs, an N-terminal transmembrane domain, and C-terminal ankyrin repeats. The acyl-CoA-binding domain functions in binding long-chain acyl-CoAs, while the transmembrane domain targets the protein to the plasma membrane. The ankyrin repeats mediate protein-protein interactions, particularly with proteins like ethylene-responsive element-binding protein (AtEBP) . Site-directed mutagenesis studies have confirmed the functionality of the acyl-CoA-binding domain and identified four conserved residues crucial for palmitoyl-CoA binding .

Where is ACBP2 localized in plant cells?

ACBP2 is primarily localized to the plasma membrane, as demonstrated through ACBP2:GFP fusion proteins transiently expressed in onion epidermal cells. This localization is directed by its N-terminal transmembrane domain . Additionally, research utilizing DsRed:ACBP2 fusion proteins in tobacco leaves has confirmed its plasma membrane localization . ACBP2 is also expressed in embryos at various stages of seed development and in guard cells, as confirmed by immunolocalization using ACBP2-specific antibodies and transgenic plants expressing ACBP2pro:GUS, which showed beta-glucuronidase staining in guard cells .

What are the primary functions of ACBP2 in Arabidopsis?

ACBP2 serves multiple functions:

  • Lipid Metabolism: Acts as an intracellular acyl-CoA transporter, binding long-chain acyl-CoAs and maintaining acyl-CoA pools . It specifically binds to linoleoyl-CoA and linolenoyl-CoA in vitro and likely transfers acyl-CoA esters to the plasma membrane .

  • Stress Response: Mediates cadmium [Cd(II)] tolerance and plays a crucial role in the drought response through ABA signaling . Overexpression of ACBP2 enhances drought tolerance by promoting ABA-mediated reactive oxygen species (ROS) production in guard cells, leading to stomatal closure and reduced water loss .

  • Embryogenesis: Essential for embryo development, as evidenced by the embryo-lethal phenotype of acbp1acbp2 double mutants . ACBP2 is proposed to be involved in lipid transfer during early embryogenesis .

How can I express and purify recombinant ACBP2 for in vitro studies?

For recombinant ACBP2 expression and purification, researchers typically use bacterial expression systems. The methodological approach includes:

  • Cloning: The ACBP2 coding sequence should be amplified from Arabidopsis cDNA and cloned into an appropriate expression vector (e.g., pET series for E. coli).

  • Expression: Transform the construct into an E. coli strain optimized for protein expression (BL21(DE3) or similar). Culture at 37°C until OD600 reaches 0.6-0.8, then induce with IPTG (typically 0.1-1 mM) for 3-4 hours at 30°C or overnight at 16°C to reduce inclusion body formation.

  • Purification: Harvest cells by centrifugation and lyse using sonication or a French press in a suitable buffer (e.g., PBS with protease inhibitors). For His-tagged ACBP2, use Ni-NTA affinity chromatography, followed by size exclusion chromatography for higher purity.

  • Verification: Confirm protein identity and purity using SDS-PAGE, Western blotting, and mass spectrometry. Assess functionality through acyl-CoA binding assays using radiolabeled substrates such as [14C]linoleoyl-CoA and [14C]linolenoyl-CoA as demonstrated in previous studies .

What methods are effective for studying ACBP2 protein-protein interactions?

Several complementary techniques have proven effective:

  • Yeast Two-Hybrid Analysis: This has been successfully used to demonstrate ACBP2 interaction with AtEBP via its ankyrin repeats . The interaction was abolished when the ankyrin repeats were removed, confirming their importance in mediating protein-protein interactions .

  • In Vitro Protein-Binding Assays: These can validate interactions identified by yeast two-hybrid screens. Pull-down assays using purified recombinant proteins can confirm direct interactions .

  • Co-localization Studies: Fluorescent protein fusions (such as DsRed:ACBP2 and GFP:AtEBP) expressed in plant tissues through agroinfiltration can determine whether potential interacting proteins localize to the same subcellular compartments. For instance, co-expression of DsRed:ACBP2 and GFP:AtEBP revealed common localization at the plasma membrane .

  • Bimolecular Fluorescence Complementation (BiFC): This technique can visualize protein interactions in planta and confirm their subcellular location.

How does ACBP2 contribute to drought tolerance in Arabidopsis?

ACBP2 enhances drought tolerance through multiple mechanisms:

  • ABA Signaling Modulation: ACBP2 is induced by both ABA and drought conditions. Transgenic plants overexpressing ACBP2 (ACBP2-OXs) show increased sensitivity to ABA treatment during germination and seedling development .

  • ROS Production Regulation: ACBP2 overexpression enhances ABA-mediated reactive oxygen species (ROS) production in guard cells. RNA analyses revealed that ACBP2 overexpression up-regulates the expression of Respiratory Burst Oxidase Homolog D (AtrbohD) and AtrbohF, two NAD(P)H oxidases essential for ABA-mediated ROS production .

  • Negative Regulator Suppression: ACBP2 overexpression down-regulates Hypersensitive to ABA1 (HAB1), an important negative regulator in ABA signaling .

  • Stomatal Regulation: The enhanced ROS production in guard cells promotes stomatal closure, reducing water loss and thereby enhancing drought tolerance. This role is supported by beta-glucuronidase (GUS) staining in guard cells of transgenic plants expressing ACBP2pro:GUS .

In contrast, acbp2 mutant plants show decreased sensitivity to ABA in root development and increased sensitivity to drought stress, further confirming ACBP2's positive role in drought tolerance .

What is the role of ACBP2 in heavy metal tolerance?

ACBP2 plays a significant role in cadmium [Cd(II)] tolerance:

  • Protein Interactions: ACBP2 interacts with lysophospholipase 2 (lysoPL2) and farnesylated protein 6 (AtFP6) through its ankyrin repeats to mediate Cd(II) tolerance. Transgenic Arabidopsis overexpressing ACBP2, lysoPL2, or AtFP6 all display enhanced Cd(II) tolerance compared to wild-type plants .

  • Metal Binding Capacity: Recombinant ACBP2 and AtFP6 can independently bind Cd(II) in vitro, suggesting they may participate in Cd(II) translocation .

  • Phospholipid Repair: ACBP2 binds to [14C]linoleoyl-CoA and [14C]linolenoyl-CoA, implying a role in phospholipid repair following Cd(II)-induced oxidative damage. Additionally, ACBP2 binds lysophosphatidylcholine (lysoPC) in vitro, while recombinant lysoPL2 degrades lysoPC, suggesting an interactive role in overcoming Cd(II)-induced stress .

How can I measure ACBP2-mediated changes in ROS production in guard cells?

To measure ACBP2-mediated changes in ROS production in guard cells:

  • H2DCF-DA Staining: Use 2',7'-dichlorodihydrofluorescein diacetate (H2DCF-DA), a cell-permeable ROS indicator. Treat epidermal peels with H2DCF-DA (typically 10-50 μM) for 10-20 minutes, then wash and visualize using fluorescence microscopy. Quantify fluorescence intensity to measure relative ROS levels.

  • Leaf Epidermal Peel Preparation: Carefully remove the abaxial epidermis from leaves and float on buffer solutions containing ABA treatments.

  • Comparative Analysis: Compare ROS levels in guard cells of wild-type, acbp2 mutant, and ACBP2 overexpression lines under control and ABA or drought-stressed conditions.

  • Inhibitor Studies: Use ROS inhibitors (e.g., diphenyleneiodonium for NADPH oxidases) to confirm the specificity of ACBP2-mediated ROS production.

  • Gene Expression Analysis: Perform qRT-PCR to measure expression levels of ROS-producing enzymes (AtrbohD and AtrbohF) and ROS-scavenging enzymes in wild-type and ACBP2-modified plants.

What lipid species does ACBP2 interact with, and how can these interactions be characterized?

ACBP2 interacts with various lipid species:

  • Acyl-CoA Esters: ACBP2 binds long-chain acyl-CoAs, particularly unsaturated species like linoleoyl-CoA and linolenoyl-CoA . This binding can be characterized using lipid-binding assays with radiolabeled substrates like [14C]linoleoyl-CoA and [14C]linolenoyl-CoA .

  • Phospholipids: ACBP2 binds unsaturated phosphatidylcholine (PC) in vitro . It may also interact with other phospholipids, as siliques of acbp1 mutants show reduced levels of polyunsaturated species of phospholipids including PC, phosphatidylethanolamine (PE), phosphatidylinositol (PI), and phosphatidylserine (PS) .

  • Lysophospholipids: ACBP2 binds lysophosphatidylcholine (lysoPC) in vitro .

These interactions can be characterized through:

  • Radiolabeled Lipid Binding Assays: Using 14C-labeled acyl-CoAs to quantify binding affinities.

  • Liposome Binding Assays: Using fluorescently labeled lipids or liposomes.

  • Surface Plasmon Resonance (SPR): For real-time, label-free detection of ACBP2-lipid interactions.

  • Lipid Overlay Assays: Where lipids are spotted on membranes and overlaid with recombinant ACBP2.

Why is the acbp1acbp2 double mutant embryo lethal while single mutants show normal development?

The embryo lethality of the acbp1acbp2 double mutant versus the normal phenotype of single mutants reveals functional redundancy between ACBP1 and ACBP2:

  • Structural Similarity: ACBP1 and ACBP2 share 76.9% amino acid identity and both contain an acyl-CoA-binding domain, a transmembrane domain, and ankyrin repeats .

  • Complementary Expression: Both proteins are expressed in embryos at various stages of seed development. ACBP1 accumulates in cotyledonary cells of embryos, while ACBP2 is also expressed in embryos throughout seed development .

  • Lipid Transfer Function: Both proteins bind unsaturated PC and acyl-CoA esters in vitro and are proposed to be essential in lipid transfer during early embryogenesis. When both are knocked out, this essential function is completely lost, resulting in embryo lethality .

  • Compensatory Mechanisms: In single mutants, the remaining functional protein can compensate for the missing one. For example, acbp1 mutant siliques accumulate galactolipid monogalactosyldiacylglycerol (MGDG) and 18:0-CoA, but most phenotypic effects are mitigated by the presence of ACBP2 .

  • Callus Induction Defects: The double mutant is also defective in callus induction, suggesting both proteins are essential for cell proliferation and differentiation .

This embryo lethality highlights the critical and partially redundant roles of ACBP1 and ACBP2 in plant development, particularly in embryogenesis and lipid metabolism.

How can ACBP2 be used to engineer drought-resistant crops?

ACBP2 offers several strategies for engineering drought-resistant crops:

  • Transgenic Overexpression: As demonstrated in Arabidopsis, overexpression of ACBP2 enhances drought tolerance by promoting ABA-mediated ROS production in guard cells, leading to stomatal closure and reduced water loss . Similar approaches could be applied to crop species.

  • Promoter Engineering: Using stress-inducible or guard cell-specific promoters to drive ACBP2 expression could provide drought tolerance while minimizing potential developmental effects.

  • Multigene Engineering: Co-expressing ACBP2 with its interacting partners (e.g., lysoPL2 or AtFP6) or with genes involved in ABA signaling could potentially enhance drought tolerance synergistically .

  • Genome Editing: CRISPR/Cas9 could be used to modify the promoter regions of native ACBP2 orthologs in crop species to enhance their expression under drought conditions.

  • Regulatory Network Manipulation: Since ACBP2 overexpression up-regulates AtrbohD and AtrbohF while down-regulating HAB1 , targeting these downstream components directly could also enhance drought tolerance.

Before implementation, it would be essential to:

  • Identify and characterize ACBP2 orthologs in target crop species

  • Evaluate potential trade-offs between enhanced drought tolerance and other agronomic traits

  • Assess the impact on yield and product quality under both normal and stress conditions

What are the current contradictions or gaps in understanding ACBP2 function?

Several contradictions and knowledge gaps exist in ACBP2 research:

  • ABA Sensitivity vs. Stress Tolerance: While ACBP2 overexpressors show increased sensitivity to ABA during germination and seedling development, they display enhanced tolerance to drought stress . This apparent contradiction needs further investigation to understand how ABA hypersensitivity translates to improved stress tolerance.

  • Lipid Metabolism and Stress Connection: Although ACBP2 functions in both lipid metabolism and stress responses, the mechanistic link between these two roles remains unclear. How does ACBP2's ability to bind acyl-CoAs and phospholipids contribute to stress tolerance beyond potential membrane repair?

  • Protein Partner Interactions: While ACBP2 interacts with AtEBP, lysoPL2, and AtFP6 , the comprehensive interaction network and how these interactions are regulated under different conditions remain to be elucidated.

  • Subcellular Dynamics: ACBP2 is primarily localized to the plasma membrane, but AtEBP is targeted to both the nucleus and plasma membrane . The dynamics of these interactions and their regulation under different developmental or stress conditions need further investigation.

  • Evolutionary Conservation: The extent to which ACBP2 functions are conserved across plant species and how they might be adapted for crop improvement remain open questions.

  • Post-translational Regulation: Little is known about how ACBP2 activity might be regulated through post-translational modifications in response to different stresses or developmental stages.

Addressing these gaps would provide a more comprehensive understanding of ACBP2 function and its potential applications in crop improvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.