Recombinant Arabidopsis thaliana ADP,ATP carrier protein 1, mitochondrial (AAC1)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

Arabidopsis thaliana ADP,ATP carrier protein 1, mitochondrial (AAC1) is a membrane transport protein located in the inner mitochondrial membrane. The protein belongs to the Mitochondrial Carrier Family (MCF), a group of transport proteins responsible for facilitating the exchange of metabolites between the mitochondrial matrix and the cytosol . AAC1 is specifically classified as an adenylate carrier, primarily involved in the transport of adenine nucleotides. The protein is also known by several synonyms including ANT1, At3g08580, F17O14.5, ADP/ATP translocase 1, and Adenine nucleotide translocator 1 .

Genomic and Protein Structure

The AAC1 gene (At3g08580) in Arabidopsis thaliana encodes a protein that, in its mature form, consists of 311 amino acids (residues 71-381). The recombinant form typically includes the functional portion of the protein without the transit peptide that is cleaved during mitochondrial import in vivo . The amino acid sequence reveals characteristic features common to mitochondrial carrier proteins, with regions that form transmembrane domains creating a channel for adenylate transport across the inner mitochondrial membrane.

Physiological Significance

Within the plant cell, AAC1 serves as one of the most abundant adenylate transport carriers in the inner mitochondrial membrane. Along with its homologs AAC2 and AAC3, AAC1 plays a crucial role in energy metabolism by facilitating the export of ATP synthesized in the mitochondrial matrix to the cytosol, where it powers numerous cellular processes, in exchange for cytosolic ADP . This exchange mechanism is essential for maintaining cellular energy homeostasis and supporting various metabolic pathways throughout plant development and in response to environmental stresses.

Transport Mechanism and Specificity

The primary function of AAC1 is to facilitate the exchange of adenine nucleotides across the inner mitochondrial membrane. Specifically, AAC1 catalyzes the counter-exchange of ATP generated in the mitochondrial matrix for cytosolic ADP . This exchange is essential for exporting ATP produced by oxidative phosphorylation to the cytosol, while simultaneously importing ADP into the mitochondria for continued ATP synthesis.

Comparative Function Within the Adenylate Carrier Family

While AAC carriers (including AAC1, AAC2, and AAC3) represent the most abundant adenylate transporters in the inner mitochondrial membrane, they function alongside other carriers with different substrate preferences. For instance, ADNT1 preferentially exports ATP in exchange for AMP rather than ADP . This differentiation in substrate preference suggests specialized roles for different carriers in maintaining adenylate balance under various physiological conditions. The distinct but complementary functions of these carriers create a sophisticated system for regulating energy distribution throughout the cell.

Role Under Stress Conditions

The function of adenylate carriers becomes particularly important under stress conditions such as hypoxia or waterlogging, when oxygen availability limits mitochondrial electron transport chain activity. Although research specifically on AAC1 under stress is limited in the available literature, studies on related carriers like ADNT1 indicate that adenylate transport is critical for maintaining energy homeostasis during oxygen limitation . Under such conditions, the ATP/ADP ratio changes, and carriers like AAC1 may work alongside other adenylate transporters to support alternative energy-generating pathways.

Tissue-Specific Expression

AAC1 exhibits distinct expression patterns across different plant tissues, providing insight into its tissue-specific functions. Expression profiling data indicates that AAC1 is highly expressed in mature pollen and developing seeds, suggesting a critical role in supplying ATP for energy-intensive processes during pollen development and seed formation . This expression pattern aligns with the high energy demands of these reproductive tissues and underscores the importance of mitochondrial ATP export during these developmental stages.

Developmental Regulation

The expression of AAC1 varies throughout plant development, with particularly strong induction observed in senescent leaves . This upregulation during senescence suggests that AAC1 may play a specialized role in energy metabolism during the controlled degradation and nutrient recycling processes that occur as leaves age. Interestingly, this pattern differs from some other adenylate carriers; while AAC1 and APC1 show strong induction in senescent leaves, AAC3, ADNT1, ER-ANT1, and PM-ANT1 show reduced expression in the same tissues .

Hormonal Regulation

Hormone treatment significantly influences the expression of many Mitochondrial Carrier Family members, including AAC1. Meta-analysis of expression data indicates that AAC1 is negatively regulated by abscisic acid (ABA), a plant hormone involved in stress responses and developmental processes . This hormonal responsiveness suggests that AAC1 expression is modulated as part of the plant's adaptation to changing environmental conditions, potentially linking energy metabolism with hormone-mediated stress responses.

Experimental Applications

Recombinant AAC1 provides researchers with a valuable tool for investigating mitochondrial adenylate transport and plant energy metabolism. The purified protein can be used in a variety of experimental applications, including:

  1. Functional characterization of transport properties using reconstituted liposomes

  2. Structural studies to understand the molecular basis of substrate selectivity

  3. Development of inhibitors or modulators of adenylate transport

  4. Comparative studies with other adenylate carriers

  5. Generation of antibodies for immunolocalization or immunoprecipitation studies

These applications contribute to our understanding of plant energy metabolism and mitochondrial function.

Insights from Comparative Studies

Research on plant adenylate carriers has revealed functional distinctions between AAC1 and other family members. The distinct expression patterns of adenylate carriers across development and in response to hormones provide insight into their specialized functions. The strong induction of AAC1 in senescent leaves, along with moderate induction of AAC2 and APC2 and reduction of AAC3, ADNT1, ER-ANT1, and PM-ANT1, suggests a shift in adenylate transport mechanisms during leaf senescence .

Recent Findings

Recent research has expanded our understanding of the role of mitochondrial carriers in plant metabolism and stress responses. Studies on related carriers like ADNT1 have shown that disruptions in adenylate transport can significantly impact plant responses to hypoxic stress conditions . For instance, ADNT1-deficient plants exhibit altered expression of hypoxia-related genes and changes in adenylate levels, particularly increased AMP in roots under non-stress conditions . Such findings highlight the importance of adenylate transport in stress adaptation and suggest potential similar roles for AAC1.

Knowledge Gaps and Future Research

Despite significant advances, many aspects of AAC1 function remain to be elucidated. Future research directions could include:

  1. Detailed structural analysis of AAC1 to understand the molecular basis of substrate selectivity

  2. Comprehensive characterization of AAC1 function under various stress conditions

  3. Investigation of potential interactions between AAC1 and other components of mitochondrial energy metabolism

  4. Development and characterization of AAC1 mutants to further understand its physiological roles in vivo

  5. Exploration of the potential applications of AAC1 in improving crop stress tolerance

Such research would provide deeper insights into the role of AAC1 in plant energy metabolism and potentially identify applications in crop improvement.

Biotechnological Implications

Understanding the function of adenylate carriers like AAC1 has potential implications for biotechnology and agriculture. Enhanced understanding of these transporters could lead to strategies for improving plant energy efficiency, stress tolerance, or productivity. For example, modulation of adenylate transport could potentially enhance plant performance under hypoxic conditions such as flooding or waterlogging, which are increasingly common challenges in agriculture due to climate change.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method and location. Kindly consult your local distributors for precise delivery timeframes.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If dry ice shipment is desired, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
AAC1; ANT1; At3g08580; F17O14.5; ADP,ATP carrier protein 1, mitochondrial; ADP/ATP translocase 1; Adenine nucleotide translocator 1; ANT 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
71-381
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
AAC1
Target Protein Sequence
TPGEKGFTNFALDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDC FGRTIKDEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLA SGGAAGASSLLFVYSLDYARTRLANDAKAAKKGGGGRQFDGLVDVYRKTLKTDGIAGLYR GFNISCVGIIVYRGLYFGLYDSVKPVLLTGDLQDSFFASFALGWVITNGAGLASYPIDTV RRRMMMTSGEAVKYKSSLDAFKQILKNEGAKSLFKGAGANILRAVAGAGVLSGYDKLQLI VFGKKYGSGGA
Uniprot No.

Target Background

Function
ADP:ATP antiporter that mediates the import of ADP into the mitochondrial matrix for ATP synthesis, and the export of ATP to fuel the cell. It cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state). The protein operates through an alternating access mechanism, with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane.
Database Links

KEGG: ath:AT3G08580

STRING: 3702.AT3G08580.1

UniGene: At.15439

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is AAC1 and what is its primary function in Arabidopsis thaliana?

AAC1 (At3g08580) is one of three typical ADP/ATP carriers (AACs) in Arabidopsis thaliana, with the others being AAC2 (At5g13490) and AAC3 . These carriers belong to the mitochondrial carrier family (MCF) and primarily function to transport ATP and ADP across the inner mitochondrial membrane. AAC1 specifically facilitates the export of ATP synthesized in the mitochondrial matrix to the cytosol in exchange for cytosolic ADP, thereby playing a crucial role in cellular energy homeostasis. Unlike some related carriers that have evolved to transport different substrates or localize to different membranes, AAC1 maintains the classical role of mitochondrial ATP/ADP exchange .

How does AAC1 differ structurally from other adenine nucleotide transporters in plants?

AAC1 possesses a characteristic N-terminal mitochondrial targeting sequence that directs it to the inner mitochondrial membrane, which distinguishes it from related carriers that target to different cellular compartments. For example, ER-ANT1 (At5g17400) lacks this mitochondrial targeting sequence and instead localizes to the endoplasmic reticulum . Similarly, PM-ANT1 (At5g56450) has an N-terminal extension that is slightly longer than ER-ANT1 (by approximately 20 amino acids) but still lacks the distinctive mitochondrial targeting sequence of AAC1 .

In terms of substrate specificity domains, AAC1 contains specific residues that enable strong preference for ATP and ADP, whereas related carriers like ADNT1 (At4g01100) show broader substrate specificity, including the ability to transport AMP and adenosine 5-sulfophosphate (APS) .

What expression patterns does AAC1 exhibit during plant development?

AAC1 expression varies throughout plant development and across different tissues. Unlike some nucleotide transporters such as PNC1 and PNC2 whose expression declines during postgerminative growth under constant darkness , AAC1 maintains relatively consistent expression in metabolically active tissues. This expression pattern reflects its fundamental role in cellular energy provision.

For context, other carriers show distinct expression patterns - ADNT1, for instance, is highly expressed in non-photosynthetic and fast-growing tissues, suggesting a specialized role in supporting the energy demands of heterotrophic tissues . Comparative expression analyses are valuable for understanding the tissue-specific roles of different adenine nucleotide transporters.

How do AAC1 transport kinetics compare with other plant adenine nucleotide carriers?

The transport kinetics of AAC1 differ significantly from other plant adenine nucleotide carriers. While specific kinetic data for AAC1 is not provided in the search results, we can make comparisons with related transporters. For example, peroxisomal adenine nucleotide carriers (PNCs) show distinct substrate preferences and inhibition patterns.

When examining transport inhibition by various effectors, we can see the following comparative data for related carriers:

EffectorGm PNC1 (% Transport Rate)At PNC2 (% Transport Rate)
None100.0 ± 6.5100.0 ± 22.5
ATP27.3 ± 12.928.9 ± 18.8
ADP19.8 ± 3.511.8 ± 0.9
AMP99.1 ± 13.292.3 ± 18.3
GTP78.9 ± 12.062.8 ± 12.6
GDP59.5 ± 9.664.4 ± 12.5

These data show that both ATP and ADP significantly inhibit transport activity of PNC1/PNC2, while AMP has minimal effect . AAC1, in contrast, would be expected to show strong transport activity for ATP and ADP with different inhibition patterns reflective of its specialized role in mitochondrial energy exchange.

What are the most effective methods for expressing and purifying functional recombinant AAC1?

For successful expression and purification of functional recombinant AAC1, bacterial expression systems using modified E. coli strains have proven effective for related carriers. The methodology should include:

  • Vector selection: Using vectors with strong, inducible promoters (e.g., pET system) and appropriate fusion tags to facilitate purification and detection.

  • Expression conditions: Optimizing conditions is critical - membrane proteins often require lower induction temperatures (16-20°C) and reduced inducer concentrations to prevent aggregation and inclusion body formation.

  • Solubilization and purification: Careful selection of detergents is crucial. For related carriers like PNC1, functional integration into E. coli cytoplasmic membranes has enabled demonstration of ATP and ADP import activities .

  • Activity verification: As demonstrated with Gm PNC1 and At PNC2, transport activity should be verified using radioisotope-labeled substrates (e.g., [α-32P]ATP) with different effectors to confirm substrate specificity .

When expressing AAC1 specifically, researchers should be mindful that the presence of the mitochondrial targeting sequence might interfere with proper folding in bacterial systems, so constructs with this sequence removed may yield better results for functional studies.

How can knockout or knockdown approaches be used to study AAC1 function?

RNA interference (RNAi) and CRISPR-Cas9 methods have been successfully employed to study the function of nucleotide transporters in Arabidopsis. When designing such experiments for AAC1, consider the following approach based on successful studies with related transporters:

  • RNAi construct design: For effective knockdown, design artificial genes encoding RNA capable of double-strand formation at gene-specific sequences. For example, with PNC1/PNC2, researchers selected a fragment containing base pairs 250 to 549 of the cDNA, which included a 36-bp region with complete identity to part of the second gene, enabling simultaneous knockdown of both targets .

  • Validation of knockdown efficiency: Quantify the reduction in mRNA levels using quantitative RT-PCR. In successful PNC knockdown lines, expression was reduced to 6-8% (for PNC1) and 16-19% (for PNC2) of wild-type levels .

  • Phenotypic analysis: In the case of AAC1, phenotypic analysis should focus on energy metabolism, growth rates, and response to conditions that increase energy demand. For context, pnc1/2i mutants required sucrose for germination and showed suppressed degradation of storage lipids during postgerminative growth .

  • Biochemical confirmation: Measure changes in adenine nucleotide transport in isolated mitochondria to confirm the functional impact of the knockdown.

For CRISPR-Cas9 approaches, similar techniques to those used for APOLO gene editing can be applied, with careful selection of guide RNAs and screening of homozygous deletion lines .

What techniques are most effective for studying AAC1 protein-protein interactions?

Several complementary techniques can be employed to identify and characterize AAC1 protein-protein interactions:

  • Affinity purification coupled with mass spectrometry: This approach has been successfully used to identify protein interaction partners for various carriers. For example, Chromatin isolation by RNA purification (ChIRP) followed by protein precipitation and mass spectrometry identified VIM1 as an interaction partner of APOLO .

  • Co-immunoprecipitation (Co-IP): Using epitope-tagged versions of AAC1 (e.g., GFP-AAC1) for immunoprecipitation followed by western blotting to detect interacting proteins. Similar approaches with GFP-VIM1 successfully demonstrated interactions with APOLO transcripts .

  • Yeast two-hybrid (Y2H) screening: While challenging for membrane proteins, modified split-ubiquitin Y2H systems can be effective for identifying AAC1 interaction partners.

  • Bimolecular fluorescence complementation (BiFC): This in vivo technique can confirm protein-protein interactions and provide information about their subcellular localization.

  • Protein crosslinking: Chemical crosslinking combined with mass spectrometry can capture transient or weak interactions that might be missed by other methods.

For AAC1 specifically, these approaches should be adapted to account for its membrane localization and the potential challenges of working with mitochondrial proteins.

How can transport activity of AAC1 be accurately measured in vitro?

Accurate measurement of AAC1 transport activity requires:

  • Reconstitution into liposomes: Purified AAC1 should be reconstituted into liposomes with a defined lipid composition that mimics the mitochondrial inner membrane.

  • Transport assays: Employ radioisotope-labeled substrates (e.g., [α-32P]ATP) to measure transport rates. The experimental approach should include:

    • Varying substrate concentrations to determine kinetic parameters (Km, Vmax)

    • Testing potential inhibitors to establish specificity

    • Examining effects of pH and membrane potential

  • Counter-exchange experiments: Since AAC1 functions as an antiporter, measuring both import and export of labeled substrates is necessary.

  • Competition assays: As demonstrated with PNC transporters, adding unlabeled potential substrates as competitors can help establish substrate specificity. For example, PNC1 and PNC2 transport was strongly inhibited by ATP (reduced to 27.3% and 28.9% of control rates, respectively) and ADP (reduced to 19.8% and 11.8%), but minimally affected by AMP .

  • Thermostability assays: These can provide insights into how substrate binding affects protein stability and can be used to screen for conditions that optimize AAC1 function.

What imaging approaches best reveal AAC1 localization and dynamics?

For studying AAC1 localization and dynamics, the following imaging approaches are recommended:

  • Fluorescent protein fusions: Creating GFP-AAC1 fusion proteins allows visualization of subcellular localization in living cells. This approach has been successfully used with related proteins such as VIM1, confirming its nuclear localization regardless of co-expression with APOLO transcripts .

  • Confocal microscopy: High-resolution confocal microscopy with mitochondrial counter-stains (e.g., MitoTracker) can confirm AAC1 localization to mitochondria and reveal any heterogeneity in distribution across the mitochondrial network.

  • Super-resolution microscopy: Techniques such as STED or PALM can provide nanoscale resolution of AAC1 distribution within mitochondrial membranes.

  • FRAP (Fluorescence Recovery After Photobleaching): This technique can measure the mobility of AAC1 within the mitochondrial membrane and detect potential interactions that might restrict its movement.

  • Multi-color imaging: Co-expressing AAC1 with other fluorescently tagged mitochondrial proteins can reveal potential co-localization and functional relationships.

When designing these experiments, it's important to verify that the fluorescent tag doesn't interfere with AAC1 targeting or function, as has been demonstrated for transient expression of GFP-VIM1 in Nicotiana benthamiana and A. thaliana leaves .

How do plant AACs differ from their counterparts in other organisms?

Plant AACs, including Arabidopsis AAC1, share fundamental functional properties with their counterparts in other organisms but exhibit important differences:

  • Structural adaptations: Plant AACs possess plant-specific structural features that may reflect adaptation to plant cellular environments and metabolic requirements.

  • Isoform diversity: Arabidopsis has three AAC isoforms (AAC1, AAC2, AAC3), whereas some other organisms have different numbers, reflecting diverse metabolic needs across species.

  • Specialized related transporters: Plants have evolved specialized AAC-related transporters not found in other lineages. For example, ER-ANT1 in Arabidopsis has no clear ortholog in yeast or animals, suggesting that plants developed unique mechanisms for ATP transport into the ER .

  • Regulatory mechanisms: The regulation of plant AACs responds to plant-specific signals including light/dark transitions and photosynthetic activity.

Understanding these evolutionary distinctions is crucial for interpreting experimental results and developing plant-specific research approaches.

What insights can be gained from studying AAC1 in relation to other plant metabolite transporters?

Comparative analysis of AAC1 with other plant metabolite transporters provides several valuable insights:

  • Functional diversification: The plant mitochondrial carrier family has undergone significant functional diversification. While AAC1 maintains the classical role of ATP/ADP exchange, related carriers have evolved new functions, such as ADNT1 which prefers AMP as a counter-exchange substrate for ATP .

  • Subcellular specialization: Plant cells have developed specialized nucleotide transporters for different organelles. Beyond mitochondrial AACs, plants possess peroxisomal (PNC1/PNC2), ER (ER-ANT1), and plasma membrane (PM-ANT1) adenine nucleotide transporters .

  • Integration with metabolism: Studying AAC1 alongside other transporters reveals how energy metabolism is coordinated across cellular compartments. For example, ADNT1 is proposed to stimulate mitochondrial energy provision in heterotrophic tissues by facilitating import of cytosolic AMP in exchange with mitochondrial ATP .

  • Developmental regulation: Different transporters show distinct expression patterns during development. PNC1/PNC2 expression declines during postgerminative growth under darkness , while other carriers show different patterns, reflecting their specialized roles.

What are common pitfalls when working with recombinant AAC1 and how can they be avoided?

Researchers frequently encounter several challenges when working with recombinant AAC1:

  • Protein aggregation and misfolding: As a membrane protein, AAC1 tends to aggregate when overexpressed. This can be mitigated by:

    • Reducing expression temperature (16-20°C)

    • Using specialized E. coli strains designed for membrane protein expression

    • Including stabilizing agents during purification

    • Removing the mitochondrial targeting sequence from expression constructs

  • Loss of activity during purification: Maintaining the functional integrity of AAC1 during extraction and purification is challenging. To preserve activity:

    • Carefully select detergents that maintain protein structure and function

    • Minimize exposure to harsh conditions

    • Include cardiolipin or other mitochondrial lipids during purification and reconstitution

  • Reconstitution difficulties: Successful reconstitution into liposomes requires optimization of:

    • Lipid composition to mimic the mitochondrial inner membrane

    • Protein-to-lipid ratios

    • Buffer conditions and pH

  • Verification of correct orientation: Ensuring that AAC1 is inserted into liposomes with the correct orientation is critical for meaningful transport assays.

These challenges can be addressed using strategies that have proven successful with related carriers, such as the methods used to demonstrate ATP and ADP transport by recombinant PNC1 and PNC2 .

How can contradictory data about AAC1 function be reconciled and addressed?

When faced with contradictory data regarding AAC1 function, researchers should consider the following strategies:

  • Experimental context: Different experimental systems (in vitro reconstitution, heterologous expression, in vivo studies) may yield apparently contradictory results. For example, a protein might show different substrate preferences in reconstituted systems versus in vivo conditions.

  • Post-translational modifications: Check whether the contradictions might result from differences in post-translational modifications of AAC1 under different conditions.

  • Interaction partners: The presence or absence of interaction partners can significantly alter AAC1 function. For instance, if AAC1 interacts with regulatory proteins similar to how VIM1 interacts with APOLO , these interactions could modify activity in specific contexts.

  • Technical validation: Employ multiple independent techniques to measure the same parameters. For example, if transport assays yield conflicting results, validate with structural studies, binding assays, and in vivo functional tests.

  • Genetic background effects: In knockout/knockdown studies, the genetic background can influence phenotypic outcomes. The generation of multiple independent transgenic lines, as demonstrated with PNC1/PNC2 knockdown plants , helps distinguish true effects from background variations.

By systematically addressing these potential sources of contradiction, researchers can develop a more accurate understanding of AAC1 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.