Recombinant Arabidopsis thaliana ADP,ATP carrier protein 2, mitochondrial (AAC2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondria

AAC2 catalyzes the antiport of ADP and ATP across the mitochondrial inner membrane, maintaining nucleotide homeostasis during oxidative phosphorylation. Its activity is regulated by:

  • Calcium (Ca²⁺): Binds via N-terminal EF-hand motifs, enhancing ATP transport over Mg²⁺-complexed ATP .

  • Cardiolipin (CL): The phospholipid stabilizes AAC2 conformation and its interactions with respiratory supercomplexes (RSCs) .

Table 2: Key Functional Properties of AAC2

PropertyDescriptionSource
Transport MechanismElectroneutral exchange of ADP³⁻ and ATP⁴⁻ via a channel-like structure
OligomerizationForms homodimers; multimerization requires RSCs and CL
CL DependencyCL depletion reduces AAC2 stability and RSC interactions

Recombinant Production and Applications

AAC2 is produced in E. coli for structural and functional studies. Key methods and applications include:

  • Expression: Full-length protein (75–385 aa) with His-tag for Ni-NTA affinity purification .

  • Purification: Lyophilized powder stored at -20°C/-80°C to prevent degradation .

  • Uses:

    • Biochemical Assays: Reconstituted liposomes for transport kinetics .

    • Structural Studies: BN-PAGE and cryo-EM to analyze RSC interactions .

Interaction with Respiratory Supercomplexes

AAC2 associates with complexes III and IV, forming RSCs critical for efficient electron transport. CL and RSC assembly stabilize AAC2 multimers, while CL deficiency disrupts these interactions .

Protein Misfolding and Import Defects

Mutations (e.g., A128P, A137D) in AAC2 cause misfolding, leading to:

  • TOM Complex Arrest: Increased association with Tom40 in mitochondria .

  • Reduced IMM Integration: >70% loss of mature AAC2 in double mutants .

Role in Oxidative Stress

AAC2 modulates mitochondrial redox balance under stress. Overexpression in Arabidopsis enhances tolerance to drought and light stress, though precise mechanisms require further study .

Comparative Analysis of AAC2 in Model Organisms

OrganismKey FeaturesSource
ArabidopsisThree APC isoforms (AtAPC1-3); Ca²⁺-regulated ATP/Mg²⁺ transport
SaccharomycesAAC2 homodimers; CL-dependent RSC assembly
Homo sapiensANT1 mutations linked to progressive external ophthalmoplegia (PEO)

Challenges and Future Directions

  • Structural Resolution: No crystal structure exists for plant AAC2; cryo-EM studies are pending .

  • Therapeutic Potential: Targeting AAC2 interactions with CL or RSCs may treat PEO or mitochondrial disorders .

References and Data Sources

  1. MyBioSource: Recombinant AAC2 product specifications .

  2. Creative BioMart: Full-length AAC2 production details .

  3. Science Advances: CL-dependent AAC2 multimerization .

  4. PMC: Biochemical characterization of plant APCs .

  5. Frontiers in Plant Science: Structural insights into mitochondrial proteins .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are open to fulfilling specific format requests. Please indicate your desired format in the order notes for us to accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is preferred, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. For reconstitution, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our products is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
While the tag type is decided during production, if you have specific tag requirements, please inform us, and we will prioritize developing your specified tag.
Synonyms
AAC2; ANT2; At5g13490; T6I14_20; ADP,ATP carrier protein 2, mitochondrial; ADP/ATP translocase 2; Adenine nucleotide translocator 2; ANT 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
75-385
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
AAC2
Target Protein Sequence
APGEKGFTNFAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGRLTEPYKGIRDC FGRTIRDEGIGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDKDGYWKWFAGNLA SGGAAGASSLLFVYSLDYARTRLANDSKSAKKGGGERQFNGLVDVYKKTLKSDGIAGLYR GFNISCAGIIVYRGLYFGLYDSVKPVLLTGDLQDSFFASFALGWLITNGAGLASYPIDTV RRRMMMTSGEAVKYKSSFDAFSQIVKKEGAKSLFKGAGANILRAVAGAGVLAGYDKLQLI VFGKKYGSGGA
Uniprot No.

Target Background

Function
ADP:ATP antiporter, essential for mitochondrial ATP synthesis, facilitates the import of ADP into the mitochondrial matrix and export of ATP to fuel cellular processes. This transport occurs through a cyclical process involving the cytoplasmic-open state (c-state) and the matrix-open state (m-state), utilizing an alternating access mechanism with a single substrate-binding site alternately exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane.
Database Links

KEGG: ath:AT5G13490

STRING: 3702.AT5G13490.1

UniGene: At.127

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is AAC2 and what is its primary function in Arabidopsis thaliana?

AAC2 (ADP/ATP carrier protein 2) is a mitochondrial membrane transporter belonging to the mitochondrial carrier family in Arabidopsis thaliana. Its primary function involves the exchange of ATP and ADP across the inner mitochondrial membrane, playing a critical role in cellular energy metabolism . The protein facilitates the export of ATP synthesized in the mitochondrial matrix to the cytosol while importing ADP for continued ATP synthesis. This exchange is essential for maintaining energy homeostasis in the cell and supporting various ATP-dependent cellular processes. The ADP/ATP catalyzing function of AAC2 has been shown to be conserved between yeast and plants, indicating its evolutionary importance across diverse organisms .

How is AAC2 structurally characterized and where is it precisely localized?

AAC2 is characterized as an integral membrane protein located in the inner mitochondrial membrane. Structurally, it belongs to the mitochondrial carrier family, which typically feature six transmembrane domains arranged in three repeats . While the precise crystal structure of Arabidopsis AAC2 is not detailed in the provided search results, research has demonstrated its importance in maintaining the structural integrity of mitochondrial cristae . Visualization studies using GFP fusion proteins confirm its mitochondrial localization, as evidenced by experiments where AAC2-GFP constructs specifically target to mitochondria . Ultrastructural analysis reveals that dysfunction of AAC2 leads to abnormal cristae morphology, suggesting its integral role in maintaining proper mitochondrial membrane architecture .

What phenotypes are associated with AAC2 mutations in Arabidopsis?

Mutations in AAC2, particularly the dominant A199D mutation, result in several distinctive phenotypes:

  • Mitochondrial cristae degradation: Ultrastructural analysis demonstrates that central cell mitochondria expressing the dominant AAC2-A199D mutant lack regular cristae formation .

  • Inhibition of nuclear fusion: In transgenic plants expressing the AAC2-A199D mutation in the central cell, researchers observed unfused polar nuclei, indicating that mitochondrial function is essential for nuclear fusion processes .

  • Extended cellular lifespan: Expression of the AAC2-A199D dominant mutation in the central cell inhibits programmed cell death (PCD) in adjacent antipodal cells, suggesting a non-cell autonomous role for mitochondrial function in regulating cellular lifespan .

  • Disrupted electron transport chain: The AAC2-A199D mutation impairs the electron transport chain, resulting in mitochondrial membrane uncoupling similar to effects observed in yeast models .

How does the dominant A199D mutation in AAC2 affect mitochondrial function and cellular processes?

The A199D mutation in AAC2 represents a fascinating research tool for understanding mitochondrial function. This dominant mutation was initially characterized in yeast and subsequently introduced into Arabidopsis AAC2 for functional studies . The mutation causes several interrelated effects:

  • Cristae degradation: Ultrastructural analysis revealed that central cell mitochondria expressing AAC2-A199D lack regular cristae formation . This structural alteration fundamentally impairs mitochondrial function.

  • Membrane uncoupling: The mutation impairs the electron transport chain, resulting in uncoupling of the mitochondrial membrane . This uncoupling disrupts the proton gradient necessary for efficient ATP synthesis.

  • Inhibition of polar nuclei fusion: Expression of AAC2-A199D in the central cell prevents fusion of polar nuclei, a process normally dependent on proper mitochondrial function . This confirms previous research suggesting mitochondrial involvement in nuclear fusion events.

  • Non-cell autonomous effects on programmed cell death: Perhaps most intriguingly, the expression of AAC2-A199D in the central cell extends the lifespan of adjacent antipodal cells by inhibiting their programmed cell death . This effect occurs despite the mutation being expressed only in the central cell, not in the antipodal cells themselves, revealing a previously unknown non-cell autonomous role for mitochondria in regulating cellular lifespan.

This mutation provides a valuable experimental system for studying both cell-autonomous and non-cell autonomous effects of mitochondrial dysfunction.

What is the relationship between AAC2 activity and programmed cell death in plants?

The relationship between AAC2 and programmed cell death (PCD) represents a significant research area revealed through studies of AAC2 mutations. Key findings include:

These findings extend our understanding of mitochondria-associated lifespan regulation beyond the traditional cell-autonomous view.

How can expression of modified AAC2 be targeted to specific cell types for research applications?

Cell-specific expression of modified AAC2 variants has proven instrumental in understanding the protein's function in different cellular contexts. Researchers have employed several strategies:

  • Promoter-driven expression: Studies have successfully used cell-type-specific promoters to drive expression of AAC2 variants in targeted cell populations:

    • The MEA promoter has been used to drive expression specifically in the central cell

    • The HSFa2 promoter has been employed for expression in antipodal cells

  • Fusion with fluorescent proteins: AAC2-GFP fusion constructs allow for both cell-specific expression and visual confirmation of localization:

    • The pMEA::aac2 A199D_GFP construct enables both visualization and functional analysis in the central cell

    • Fluorescent tagging confirms proper mitochondrial targeting of the fusion protein

  • Transformation methods: Agrobacterium-mediated transformation, particularly the floral dipping method, provides an efficient approach for generating transgenic Arabidopsis lines expressing modified AAC2 . This method allows for the generation of numerous independent transformants with a single treatment.

  • Selection systems: The use of appropriate selectable markers allows for the identification of transformants carrying the modified AAC2 constructs. Typically, hemizygous plants segregate approximately 50% gametophytes expressing the construct .

This targeted expression approach has been crucial for determining the cell-specific and non-cell autonomous functions of AAC2.

What experimental systems are most effective for studying AAC2 function in mitochondria?

Several experimental systems have proven valuable for investigating AAC2 function:

  • Transgenic expression systems:

    • Cell-specific promoters (MEA, HSFa2) driving AAC2 variants allow for targeted expression studies

    • Dominant negative mutations like AAC2-A199D provide powerful tools for disrupting mitochondrial function

    • GFP fusion constructs enable simultaneous localization and functional analysis

  • Microscopy techniques:

    • Cleared whole mounts for analyzing gametophyte morphology

    • Ultrastructural analysis through electron microscopy for examining mitochondrial cristae integrity

    • Fluorescence microscopy for tracking GFP-tagged AAC2 localization

  • Genetic approaches:

    • Insertional mutagenesis using T-DNA for generating AAC2 mutants

    • Comparative analysis between wild-type and mutant phenotypes

    • Complementation studies to confirm gene function

  • Comparative systems:

    • Yeast as a model system for studying conserved functions of AAC proteins

    • Cross-species analysis to identify conserved features of AAC2 function

Experimental ApproachApplications for AAC2 ResearchKey Advantages
Promoter-driven expressionCell-specific functional analysisAllows isolation of effects to specific cell types
Dominant mutations (A199D)Disruption of mitochondrial functionProvides stronger phenotypes than loss-of-function
Ultrastructural analysisMitochondrial cristae examinationDirect visualization of structural effects
GFP fusion proteinsProtein localization studiesConfirms mitochondrial targeting
Whole-mount clearingGametophyte developmental analysisEnables visualization of cellular structures

How can researchers design experiments to study non-cell autonomous effects of AAC2 dysfunction?

Designing experiments to investigate the non-cell autonomous effects of AAC2 requires careful consideration of several factors:

  • Cell-specific expression systems:

    • Utilize well-characterized cell-specific promoters (e.g., MEA for central cells)

    • Compare effects of expressing the same construct in different cell types (e.g., central cells vs. antipodal cells)

    • Include appropriate controls with wild-type AAC2 to distinguish mutation-specific effects

  • Phenotypic analysis:

    • Examine effects in both the cells expressing modified AAC2 and adjacent cells

    • Use cleared whole mounts to assess developmental and morphological changes

    • Implement time-course studies to track progression of effects

  • Molecular markers:

    • Use markers for programmed cell death to quantify effects on cellular lifespan

    • Employ nuclear markers to assess effects on nuclear fusion events

    • Implement mitochondrial function indicators to correlate dysfunction with phenotypes

  • Complementation and rescue experiments:

    • Test whether providing wild-type AAC2 in affected cells can rescue phenotypes

    • Investigate whether chemical manipulation of mitochondrial function can mimic or rescue effects

A particularly effective experimental design demonstrated in the literature involved expressing the dominant AAC2-A199D mutation in the central cell using the MEA promoter and then examining effects on both central cell mitochondria and antipodal cell lifespan . By comparing these results with expression of the same construct in antipodal cells using the HSFa2 promoter, researchers established the directional nature of the signaling between these cell types.

What methods are available for producing and analyzing recombinant AAC2 for in vitro studies?

For in vitro studies of recombinant AAC2, researchers can employ several methodological approaches:

  • Expression systems:

    • Bacterial expression systems (E. coli) for producing recombinant AAC2

    • Yeast expression systems that may better preserve mitochondrial protein functionality

    • Insect cell or plant cell-based expression systems for more native-like post-translational modifications

  • Purification strategies:

    • Affinity chromatography using histidine or other tags

    • Ion exchange chromatography for separating charged variants

    • Size exclusion chromatography for final purification and analysis of oligomeric state

  • Functional assays:

    • Reconstitution into proteoliposomes for transport assays

    • ATP/ADP exchange activity measurements

    • Membrane potential assays to assess effects on proton gradients

  • Structural analysis:

    • Circular dichroism for secondary structure assessment

    • Crystallization trials for X-ray diffraction studies

    • Cryo-electron microscopy for structural determination in a more native state

Commercial sources now offer recombinant Arabidopsis thaliana AAC2 protein for research applications, with prices around $1,630.00 per unit according to suppliers like MyBioSource.com . While this commercial availability facilitates some studies, many research applications still require custom-produced protein with specific modifications or tags.

How might AAC2 research inform our understanding of mitochondrial function across species?

AAC2 research in Arabidopsis provides valuable insights with cross-species implications:

  • Evolutionary conservation: The catalytic function of AAC2 is conserved between yeast and plants, suggesting fundamental importance across eukaryotes . This conservation extends to the effects of specific mutations, as demonstrated by the similar impacts of the A199D mutation in both organisms.

  • Mitochondrial dynamics: Studies in Arabidopsis reveal that mitochondrial dysfunction can affect cellular lifespan in a non-cell autonomous manner, extending current views of mitochondria-associated lifespan regulation . This finding may prompt investigations of similar phenomena in other species, including animals.

  • Aging mechanisms: The observation that reactive oxygen species accumulating as byproducts of a functional electron transport chain may enhance aging through damaging effects on mitochondrial DNA aligns with theories from yeast, invertebrates, and mammals . This supports an evolutionary conserved role for mitochondria in lifespan regulation.

  • Nuclear-mitochondrial interactions: AAC2 research confirms the proposed role of mitochondria during nuclear fusion , highlighting the importance of nuclear-mitochondrial communication across species.

  • Translational approaches: Methodologies developed for studying AAC2 in Arabidopsis, such as dominant negative mutations and cell-specific expression systems, may be adaptable to other plant species and potentially to animal models, facilitating comparative studies of mitochondrial function.

As noted in the research, "seemingly paradox, the reduction of mitochondria function can also extend lifespan as shown for Caenorhabditis elegans and Drosophila" , suggesting complex and possibly conserved relationships between mitochondrial function and cellular lifespan that merit further cross-species investigation.

What are the agricultural and biotechnological implications of AAC2 research?

AAC2 research has several potential agricultural and biotechnological applications:

  • Stress response engineering: Understanding how mitochondrial function affects cellular lifespan could inform strategies for enhancing plant stress tolerance. Research in Arabidopsis has demonstrated that overexpression of proteins involved in cell death regulation can reduce disease symptoms and potentially enhance pathogen resistance .

  • Developmental control: The role of AAC2 in regulating programmed cell death suggests potential applications in controlling plant development. Manipulating mitochondrial function in specific tissues could potentially alter developmental timing or response to environmental conditions.

  • Translational phenotyping: Insights from Arabidopsis AAC2 studies may inform "translational phenotyping" approaches in crops. As noted in research on drought stress, "in order to generate comparable datasets across species under drought, ensuring that a specific reaction of interest—be it molecular or morpho-physiological—is present at a similar level in the two species under even dissimilar environments may be more useful operationally than struggling to precisely impose the same stress to the two species" . Similar principles could apply to studies of mitochondrial function across species.

  • Reproductive biology applications: The impact of AAC2 function on female gametophyte development suggests potential applications in reproductive biology. As noted in the research, "small-scale molecular changes can affect complex reproductive traits" , which could be relevant for crop improvement.

  • Model systems for metabolic engineering: The AAC2 system provides a valuable model for understanding how alterations in energy metabolism affect plant development and stress responses, potentially informing metabolic engineering approaches in crops.

These applications align with the growing recognition that fundamental research in model organisms like Arabidopsis can inform practical applications in agriculture, though careful consideration of species-specific differences remains essential for successful translation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.