Recombinant Arabidopsis thaliana ADP,ATP carrier protein 3, mitochondrial (AAC3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: All protein shipments default to standard blue ice packs. If dry ice shipping is required, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
AAC3; ANT3; At4g28390; F20O9.60; ADP,ATP carrier protein 3, mitochondrial; ADP/ATP translocase 3; Adenine nucleotide translocator 3; ANT 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
70-379
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
AAC3
Target Protein Sequence
APSEKTGTGFLIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGISDC FARTVKDEGMLALWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKEKDGYWKWFAGNLA SGGAAGASSLLFVYSLDYARTRLANDAKAAKKGGQRQFNGMVDVYKKTIASDGIVGLYRG FNISCVGIVVYRGLYFGLYDSLKPVVLVDGLQDSFLASFLLGWGITIGAGLASYPIDTVR RRMMMTSGEAVKYKSSLQAFSQIVKNEGAKSLFKGAGANILRAVAGAGVLAGYDKLQLIV LGKKYGSGGG
Uniprot No.

Target Background

Function
ADP:ATP antiporter mediates the import of ADP into the mitochondrial matrix for ATP synthesis and the export of ATP to fuel cellular processes. It cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state), operating by the alternating access mechanism with a single substrate-binding site that is intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane.
Database Links

KEGG: ath:AT4G28390

STRING: 3702.AT4G28390.1

UniGene: At.44823

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.