Recombinant Arabidopsis thaliana ADP,ATP carrier protein ER-ANT1 (ER-ANT1)

Shipped with Ice Packs
In Stock

Description

Biochemical Characterization of ER-ANT1

ER-ANT1 belongs to the mitochondrial carrier family (MCF) but is phylogenetically distinct from mitochondrial ADP/ATP carriers (AACs) . Key biochemical features include:

Subcellular Localization and Tissue-Specific Expression

Immunogold labeling and transgenic studies confirm ER-ANT1’s exclusive localization in ER membranes, particularly in metabolically active tissues:

  • High Expression Sites: Pollen grains, root tips, vascular bundles, and developing seeds .

  • Promoter Activity: Strong β-glucuronidase (GUS) signals in ER-active tissues correlate with its role in energy-demanding processes like protein secretion and lipid biosynthesis .

Physiological Role in Arabidopsis Development

ER-ANT1 is essential for plant growth and survival:

  • Root Development: Knockout mutants (er-ant1) exhibit stunted root growth, which is partially rescued on low-agar media .

  • Seed Maturation: Mutant seeds show 40–50% reductions in protein and lipid content, highlighting ER-ANT1’s role in nutrient storage .

  • ER Stress Response: Loss of ER-ANT1 downregulates ER chaperones (BiP1–3, calreticulin1–2) and the translocation channel SEC61γ, indicating ATP scarcity disrupts protein folding .

Knockout Mutant Phenotypes

Two independent er-ant1 T-DNA insertion lines (SALK_025291 and SALK_036810) display:

  • Growth Retardation: 24-day-old mutants are 60–70% smaller than wild-type plants .

  • Chlorophyll Deficiency: Reduced chlorophyll levels suggest secondary metabolic disruptions .

  • Photorespiratory Defects: Elevated glycine levels and impaired glycine decarboxylase (GDC) activity link ER-ANT1 to photorespiration .

Interaction with Reactive Oxygen Species (ROS) and Photorespiration

  • ROS Accumulation: er-ant1 mutants exhibit increased hydrogen peroxide (H2O2\text{H}_2\text{O}_2) levels, likely due to mitochondrial dysfunction .

  • Photorespiratory Link: Impaired GDC activity in mutants suggests ER-ANT1 indirectly supports photorespiration by maintaining mitochondrial redox balance .

Evolutionary and Functional Insights

  • Plant-Specific Adaptation: ER-ANT1 is absent in non-vascular plants and animals, suggesting a specialized role in plant ER energetics .

  • Compensatory Mechanisms: Voltage-dependent anion channels (VDACs) may provide basal ATP transport in ER-ANT1’s absence, preventing lethality .

Recent Advances: Suppressor Mutants and Vitamin B6 Homeostasis

A 2022 suppressor screen identified a HaloAcid Dehalogenase (HAD)-type phosphatase that rescues er-ant1 phenotypes by dephosphorylating pyridoxal 5′-phosphate (PLP) :

  • PLP Metabolism: ER-ANT1 mutants show disrupted vitamin B6 homeostasis, implying ER-ANT1 may transport PLP precursors.

  • Chloroplastic Link: The suppressor enzyme localizes to chloroplasts, suggesting cross-compartmental coordination to mitigate PLP toxicity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ER-ANT1; At5g17400; T10B6_60; ADP,ATP carrier protein ER-ANT1; ADP/ATP translocase ER-ANT1; Endoplasmic reticulum-adenine nucleotide transporter 1; ER-ANT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ER-ANT1
Target Protein Sequence
MALIGKSERFSADFVMGGAAAIVAKSAAAPIERVKLLLQNQGEMIKTGHLIRPYTGLGNC FTRIYREEGVLSFWRGNQANVIRYFPTQASNFAFKGYFKNLLGCSKEKDGYLKWFAGNVA SGSAAGATTSLFLYHLDYARTRLGTDAKECSVNGKRQFKGMIDVYRKTLSSDGIKGLYRG FGVSIVGITLYRGMYFGMYDTIKPIVLVGSLEGNFLASFLLGWSITTSAGVIAYPFDTLR RRMMLTSGQPVKYRNTIHALREILKSEGFYALYRGVTANMLLGVAGAGVLAGYDQLHQIA YKHWVQ
Uniprot No.

Target Background

Function
ADP/ATP antiporter catalyzing the exchange of ADP and ATP across the endoplasmic reticulum membrane.
Gene References Into Functions
  1. Studies suggest a correlation between ER-ANT1 activity and cellular reactive oxygen species levels, indicating a functional relationship between the endoplasmic reticulum (ER) and other plant organelles. PMID: 23860249
Database Links

KEGG: ath:AT5G17400

STRING: 3702.AT5G17400.1

UniGene: At.31555

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is ER-ANT1 and what is its primary function in Arabidopsis thaliana?

ER-ANT1 is an adenine nucleotide transporter residing in the endoplasmic reticulum membranes of Arabidopsis thaliana. It functions as an ATP/ADP antiporter with high specificity, mediating the exchange of ATP and ADP across the ER membrane. Functional characterization through heterologous expression in E. coli cells has demonstrated that ER-ANT1 operates in a counterexchange mode, similar to mitochondrial adenine nucleotide carriers (AACs), exchanging ATP and ADP in a 1:1 stoichiometry .

The primary function of ER-ANT1 appears to be providing ATP to the ER lumen for energy-dependent processes. Many metabolic reactions in the ER require high levels of ATP for proper functioning, including protein folding, calcium homeostasis, and secretory pathway operations. In vivo, ER-ANT1 likely mediates ATP uptake into the plant ER coupled to the export of ADP, which is essential for maintaining balanced nucleotide levels across cellular compartments .

How has ER-ANT1 localization in the ER been experimentally confirmed?

The localization of ER-ANT1 to the endoplasmic reticulum has been confirmed through multiple complementary approaches:

  • Immunodetection in transgenic ER-ANT1-C-MYC-tag Arabidopsis plants

  • Immunogold labeling of wild-type pollen grain tissue using a peptide-specific antiserum

  • Expression pattern analysis using ER-ANT1-promoter-β-glucuronidase Arabidopsis lines

These techniques conclusively demonstrated the presence of ER-ANT1 in ER membranes, particularly in tissues with high ER activity such as pollen, seeds, root tips, apical meristems, and vascular bundles .

What kinetic properties has ER-ANT1 demonstrated in transport assays?

The nucleotide transport properties of ER-ANT1 have been characterized through heterologous expression in intact E. coli cells. Key findings include:

  • Time-linear import of both ATP and ADP for at least 25 minutes

  • Transport follows Michaelis-Menten kinetics with apparent Km values of:

    • ATP: 343.7 ± 20.4 μM

    • ADP: 327.3 ± 24.4 μM

  • High substrate specificity for ATP and ADP, with competition experiments showing:

    • [α-32P]ATP import reduced to below 44% by unlabeled ATP

    • [α-32P]ATP import reduced to below 38% by unlabeled ADP

    • No substantial influence from 24 other metabolic intermediates tested

Back-exchange experiments with [α-32P]ATP-preloaded E. coli cells demonstrated that ER-ANT1 mediates nucleotide exchange, with approximately 95% of labeled nucleotides released within 6 minutes after initiation of chase with unlabeled ATP or ADP .

What phenotypes are observed in ER-ANT1 knockout plants?

Arabidopsis mutants lacking ER-ANT1 (er-ant1 plants) exhibit several striking phenotypes:

  • Photorespiratory phenotype with high glycine levels

  • Stunted growth and dramatically retarded plant development

  • Impaired root and seed development

  • Growth retardation visible in 24-day-old homozygous knockout plants grown on soil

Interestingly, root development of ER-ANT1 knockout mutants can be improved when grown on low-agar medium (0.5% concentration), which facilitates the penetration of developing root tips. This suggests that one function of ER-ANT1 may be related to the secretory pathway involved in root tip development .

How does ER-ANT1 dysfunction affect vitamin B6 homeostasis and what is the experimental evidence?

The relationship between ER-ANT1 and vitamin B6 homeostasis was uncovered through a forward genetic screen. Researchers identified that the absence of a previously uncharacterized member of the HaloAcid Dehalogenase (HAD)-like hydrolase family strongly suppressed the dwarf phenotype of er-ant1 plants .

Experimental characterization of this suppressor gene showed:

  • The corresponding protein localizes to chloroplasts

  • Activity assays demonstrated that the enzyme dephosphorylates pyridoxal 5'-phosphate (PLP, a B6 vitamer) with high substrate affinity

  • Additional physiological experiments identified imbalances in vitamin B6 homeostasis in er-ant1 mutants

These findings suggest that the growth defects in er-ant1 plants may be related to altered PLP metabolism rather than direct inhibition of glycine decarboxylase (GDC) activity as initially hypothesized. The experimental data supports a model where ER-ANT1 may be involved in the transport of PLP, connecting chloroplastic PLP dephosphorylation to the cellular vitamin B6 homeostasis network .

What methods are most effective for studying the substrate specificity of ER-ANT1?

Based on the experimental approaches documented in the research, the following methodological framework is recommended for studying ER-ANT1 substrate specificity:

  • Heterologous expression system: Express recombinant ER-ANT1 in intact E. coli cells. This allows for functional transport assays without the complication of other plant transporters.

  • Transport assays with radioactively labeled substrates:

    • Use [α-32P]ATP or [α-32P]ADP to monitor uptake into bacterial cells

    • Measure time-dependent transport to establish linearity

    • Determine concentration dependence to calculate kinetic parameters (Km, Vmax)

  • Competition experiments:

    • Perform competition assays with at least 20-25 different potential substrates

    • Use a standard concentration (2 mM) of unlabeled competitors

    • Calculate percentage inhibition relative to control values

  • Back-exchange (efflux) experiments:

    • Preload cells with radioactively labeled [α-32P]ATP

    • Remove external label and initiate export with nonlabeled substrates

    • Monitor efflux over time to establish counterexchange mode

    • Use thin layer chromatography to analyze metabolic fate of transported nucleotides

This comprehensive approach allows for definitive characterization of substrate specificity, transport mode, and kinetic properties of ER-ANT1 .

How is ER-ANT1 structurally related to mitochondrial adenine nucleotide carriers and what does this reveal about its function?

ER-ANT1 shares significant structural similarities with mitochondrial adenine nucleotide carriers (AACs), providing insight into its transport mechanism. Key structural features include:

  • Conservation of critical amino acid residues:

    • Six of seven residues crucial for ADP/ATP transport activity in yeast mitochondrial AAC2 (R96, R204, R252, R253, R254, R294, and K38) have corresponding conserved residues in ER-ANT1 (R83, R192, R240, R241, R242, L282, and K25), with only R294 replaced by L282

    • The cationic cluster in the translocation channel of bovine AAC1 (K22, K32, R79, R137, R234, R235, R236, and R279) is conserved in ER-ANT1 (K25, K35, R83, R140, R192, R240, R241, R242, L282)

    • The "Tyr ladder" motif (Y186, Y190, Y194) suggested to guide ADP translocation in bovine AAC1 is completely conserved in ER-ANT1 (Y191, Y195, Y199)

  • Functional similarities:

    • Like mitochondrial AACs, ER-ANT1 operates in a counterexchange mode

    • Both transporters exhibit high specificity for adenine nucleotides

    • Similar kinetic properties for ATP and ADP transport

This high conservation of amino acid residues critical for the function of mitochondrial AACs strongly indicates that ER-ANT1 functions as an adenylate transport protein despite its different subcellular localization. The structural similarities suggest ER-ANT1 evolved from mitochondrial AACs but was repurposed to serve specialized functions in the plant ER .

What is the relationship between ER-ANT1 and photorespiration in Arabidopsis?

The relationship between ER-ANT1 and photorespiration in Arabidopsis presents an intriguing research puzzle. ER-ANT1 knockout mutants exhibit a photorespiratory phenotype with high glycine levels and stunted growth, initially pointing to an inhibition of glycine decarboxylase (GDC) .

  • Although ER-ANT1 mutants show photorespiratory symptoms, none of the enzymatic steps of the photorespiratory pathway are associated with the ER membrane or its lumen

  • Suppressor screen studies revealed that the dwarf phenotype of er-ant1 mutants can be rescued by the absence of a chloroplastic pyridoxal 5'-phosphate (PLP) phosphatase

  • Physiological experiments identified imbalances in vitamin B6 homeostasis in er-ant1 mutants

Current research suggests that impaired chloroplast metabolism, rather than decreased GDC activity directly, causes the er-ant1 mutant dwarf phenotype. A working hypothesis proposes that ER-ANT1 may be involved in PLP transport, linking ER function to chloroplastic processes that ultimately impact photorespiration .

This relationship remains "enigmatic" according to researchers, highlighting the need for further investigation of the mechanistic connection between ER-ANT1 function and photorespiratory metabolism .

How does ER-ANT1 deficiency impact gene expression of ER-resident proteins?

ER-ANT1 deficiency leads to significant changes in the gene expression profile of ER-resident proteins. Studies of ER-ANT1 knockout lines revealed:

  • Downregulation of ER chaperones:

    • BiP1 to BiP3 (luminal binding proteins) show reduced mRNA levels

    • Calreticulin1 and calreticulin2 expression is decreased

  • Reduced expression of calcium signaling components:

    • ER-localized Ca²⁺-dependent protein kinase CPK2 shows lowered transcript levels

  • Impact on protein translocation machinery:

    • The translocation channel subunit SEC61γ expression is strongly reduced

This pattern of gene expression changes differs from the unfolded protein response typically induced by ER stress, which involves upregulation of chaperones. Instead, the reduced energy supply into the ER lumen of ER-ANT1 knockout mutants leads to downregulation of ATP-consuming ER proteins, suggesting an adaptive response to energy limitation .

These findings indicate that ER-ANT1 plays a crucial role in maintaining proper ER function by ensuring adequate ATP supply for energy-dependent processes like protein folding, calcium homeostasis, and protein translocation. The observed gene expression changes likely contribute to the severe developmental phenotypes in ER-ANT1 knockout plants .

What techniques are recommended for studying ER-ANT1 expression patterns in plant tissues?

Based on the research methodologies described, the following approaches are recommended for studying ER-ANT1 expression patterns:

  • Promoter-reporter fusion analysis:

    • Generate transgenic ER-ANT1-promoter-β-glucuronidase (GUS) Arabidopsis lines

    • Perform histochemical GUS staining to visualize tissue-specific expression

    • This approach revealed high expression in ER-active tissues (pollen, seeds, root tips, apical meristems, vascular bundles)

  • Transcript analysis via RT-PCR:

    • Design gene-specific primers spanning exon-exon junctions

    • Use to verify absence of transcript in knockout lines

    • Can be quantitative (qRT-PCR) for measuring expression levels in different tissues

  • Protein detection methods:

    • Generate transgenic plants expressing tagged versions (e.g., ER-ANT1-C-MYC-tag)

    • Use immunodetection with tag-specific antibodies

    • Alternatively, develop peptide-specific antisera against ER-ANT1

    • Perform immunogold labeling for subcellular localization studies

These complementary approaches provide comprehensive information about both the spatial expression pattern and subcellular localization of ER-ANT1, essential for understanding its physiological roles in different plant tissues .

What experimental design would effectively identify genetic suppressors of ER-ANT1 mutant phenotypes?

To identify genetic suppressors of ER-ANT1 mutant phenotypes, researchers can implement the following experimental strategy based on successful approaches in the literature:

This approach successfully identified a HAD-type PLP phosphatase as a suppressor of the er-ant1 phenotype, revealing unexpected connections between ER-ANT1 function and vitamin B6 homeostasis .

How can researchers distinguish between direct and indirect effects of ER-ANT1 mutation?

Distinguishing between direct and indirect effects of ER-ANT1 mutation requires a multi-faceted experimental approach:

  • Temporal analysis of metabolic and transcriptomic changes:

    • Study early changes following inducible knockdown/knockout of ER-ANT1

    • Compare with later-stage alterations to identify primary versus secondary effects

    • Use time-course experiments to establish sequence of metabolic perturbations

  • Compartment-specific metabolite analysis:

    • Employ non-aqueous fractionation techniques to measure ATP/ADP ratios in different cellular compartments

    • Determine if ATP depletion occurs specifically in the ER before other metabolic changes

  • Genetic complementation strategies:

    • Create tissue-specific or inducible complementation lines

    • Determine which aspects of the phenotype are rescued immediately versus gradually

    • Use modified versions of ER-ANT1 with altered transport properties to correlate function with phenotype

  • Integration with suppressors analysis:

    • Compare metabolic profiles of er-ant1 single mutants with suppressor double mutants

    • Identify metabolic nodes that are restored in suppressor lines

    • Create a model of primary and secondary metabolic perturbations

This integrative approach can help establish causality and distinguish primary effects of ATP depletion in the ER from secondary metabolic adaptations that lead to the observed photorespiratory phenotype and growth defects .

What methods should be used to accurately measure ATP/ADP exchange activity of recombinant ER-ANT1?

For accurate measurement of ATP/ADP exchange activity of recombinant ER-ANT1, the following methodological approach is recommended:

  • Expression system selection:

    • Heterologous expression in intact E. coli cells provides a clean system without interference from endogenous plant transporters

    • Alternatively, proteoliposome reconstitution can be used for more controlled membrane environment

  • Substrate transport measurement:

    • Use radioactively labeled nucleotides ([α-32P]ATP, [α-32P]ADP) for high sensitivity

    • Measure uptake over time to establish linearity (typically 0-25 min)

    • Determine concentration dependence (100 μM to 2 mM range) for kinetic parameters

  • Exchange mode verification:

    • Perform back-exchange (efflux) experiments with preloaded cells/liposomes

    • Initiate efflux with non-labeled counter-substrates

    • Quantify release of radioactivity over time

    • Use thin layer chromatography to identify exported nucleotides

  • Controls and validation:

    • Include non-induced cells as negative controls

    • Verify membrane intactness of the expression system

    • Use known transport inhibitors to confirm specificity

    • Compare with established transporters (e.g., mitochondrial AACs)

  • Data analysis:

    • Calculate initial transport rates from linear portion of uptake curves

    • Use Michaelis-Menten equation to determine Km and Vmax values

    • For competition studies, express results as percentage of control values

This comprehensive approach has successfully characterized ER-ANT1 as an ATP/ADP antiporter with high substrate specificity and counterexchange transport mode .

How can ER-ANT1 be utilized as a tool for manipulating ER energy status in plants?

ER-ANT1 offers potential as a molecular tool for manipulating ER energy status in plants, with several research applications:

  • Controlled expression systems:

    • Generate plants with inducible over-expression or knockdown of ER-ANT1

    • Use to create controlled ATP depletion/enrichment in the ER lumen

    • Study temporal requirements for ATP in ER-dependent processes

  • Tissue-specific manipulation:

    • Express modified versions of ER-ANT1 with altered transport kinetics in specific tissues

    • Target tissues with high secretory activity (e.g., root tips, pollen)

    • Monitor effects on secretory pathway function and tissue development

  • Chimeric transporters:

    • Create fusion proteins of ER-ANT1 with regulatory domains that respond to small molecules

    • Develop conditionally active transporters to fine-tune ER ATP levels

    • Use as research tools to study energy-dependent ER processes

  • Applications in stress research:

    • Manipulate ER-ANT1 expression to enhance or reduce ATP availability during stress conditions

    • Study the relationship between ER energy status and unfolded protein response

    • Potentially enhance stress tolerance by optimizing ER energy balance

These approaches could provide valuable insights into the energy requirements of ER-dependent processes and potentially lead to strategies for improving plant performance under various conditions .

What insights does ER-ANT1 provide about the evolution of compartmentalized energy metabolism in plants?

ER-ANT1 provides several key insights into the evolution of compartmentalized energy metabolism in plants:

  • Plant-specific adaptation:

    • ER-ANT1 homologs are restricted to vascular plants, despite energy provision to the ER being required in all eukaryotes

    • This suggests ER-ANT1 evolved to fulfill a specialized role in vascular plants rather than serving as the universal ATP supplier to the ER

  • Evolutionary relationship to mitochondrial transporters:

    • ER-ANT1 shares significant structural similarities with mitochondrial AACs

    • Conservation of critical amino acid residues suggests ER-ANT1 likely evolved from mitochondrial adenine nucleotide carriers

    • Repurposing of this transporter for ER function represents an evolutionary innovation in vascular plants

  • Compartmentalization of metabolism:

    • The connection between ER-ANT1, vitamin B6 metabolism, and photorespiration reveals complex cross-talk between different organelles

    • Suggests evolution of intricate regulatory networks coordinating energy status across cellular compartments

    • Highlights the importance of transporter specialization in plant cellular evolution

  • Alternative transport systems:

    • Even in the absence of ER-ANT1, sufficient ATP supply to the ER is maintained

    • This indicates the presence of multiple, potentially redundant systems for energy provision to cellular compartments

    • Reflects evolutionary adaptations ensuring robust energy distribution in complex plant cells

These insights contribute to our understanding of how plants evolved specialized transport systems to support compartmentalized metabolism, particularly in the context of unique plant processes like photorespiration .

What are the most promising approaches for resolving the connection between ER-ANT1 and photorespiration?

To resolve the enigmatic connection between ER-ANT1 and photorespiration, researchers should consider these promising approaches:

  • Metabolic flux analysis:

    • Conduct 13C-labeling studies to trace carbon flow through photorespiratory pathways

    • Compare flux patterns between wild-type, er-ant1 mutants, and suppressor lines

    • Identify metabolic bottlenecks or altered branch points in the pathway

  • Comprehensive vitamin B6 vitamer profiling:

    • Develop sensitive analytical methods to quantify all B6 vitamers in different subcellular compartments

    • Determine if altered PLP distribution affects cofactor availability for photorespiratory enzymes

    • Test if supplementation with specific vitamin B6 forms rescues aspects of the phenotype

  • Transport studies with purified protein:

    • Test if ER-ANT1 can transport PLP in addition to adenine nucleotides

    • Develop in vitro transport assays with reconstituted proteoliposomes

    • Compare transport activities with different B6 vitamers

  • Genetic interaction studies:

    • Create double and triple mutants combining er-ant1 with mutations in photorespiratory enzymes and PLP metabolism genes

    • Perform systematic genetic interaction mapping to identify functional relationships

    • Use CRISPR/Cas9 to generate targeted mutations in key genes

  • Spatial-temporal analysis of metabolite distribution:

    • Apply imaging techniques like MALDI-MSI to visualize distribution of key metabolites

    • Use genetically encoded biosensors to monitor ATP, PLP, and glycine levels in real-time

    • Correlate metabolite dynamics with cellular responses in different genetic backgrounds

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.